Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22190-AT1G78080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):related to AP2 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.65195157677904
Log2 mRNA fold difference:-0.72409334414874
Log2 TE fold difference:1.1726642372736
Sequences
Protein sequence

MTTSMDFYSNKTFQQSDPFGGELMEALLPFIKSPSNDSSAFAFSLPAPISYGSDLHSFSH
HLSPKPVSMKQTGTSAAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAAL
AYDKAAYKLRGDFARLNFPDLRHNDEYQPLQSSVDAKLEAICQNLAETTQKQVRSTKKSS
SRKRSSTVAVKLPEEDYSSAGSSPLLTESYGSGGSSSPLSELTFGDTEEEIQPPWNENAL
EKYPSYEIDWDSILQCSSLVN

MAAAMNLYTCSRSFQDSGGELMDALVPFIKSVSDSPSSSSAASASAFLHPSAFSLPPLPG
YYPDSTFLTQPFSYGSDLQQTGSLIGLNNLSSSQIHQIQSQIHHPLPPTHHNNNNSFSNL
LSPKPLLMKQSGVAGSCFAYGSGVPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGT
FDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICK
SMAETQKQDKSTKSSKKREKKVSSPDLSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLS
DLTFADPEEPPQWNETFSLEKYPSYEIDWDSILA

www.000webhost.com

Other information
Ka divergence:0.163109KaKs divergence:0.401183
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):786Length 2 (bp):1005Length divergence:0.122
MFE 1 (kcal):-271.62MFE 2 (kcal):-341.36MFE divergence0.114