Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22220-AT1G78100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):F-box family protein
Function (paralog2):F-box family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.3192695537447
Log2 mRNA fold difference:4.5068028023871
Log2 TE fold difference:-1.5379849758991
Sequences
Protein sequence

MDVFDGLPDPIIVDILNKVGDVKTLLRCSSLSKRFNSLVPQSESLTLRLDHSVSDSPVVT
SIFRSLFNGLVSLLSKPAKPITITTLSPSLPFKILSRFDRIRNLDVELPGGDVKLEKGAA
VKWKAEFGKTLKSCVIVAFRSAGTVSSPVAVEGESDAEFVTGLKTRVVWTISALMAASSR
HYLMREVVKEHEEIESLVMRDKEREGTVVMNEEGLKELRNTEARVEDEERVVKNKRSVVP
SVRMSMRHAPSLKLKSGICLESATLVIVRPSGADFEVGDDAELATEAFVGDCMYGEAVVA
LLKCKKNALEMNSF

MDAFDAIPDPVVIDILNRVGDVKTLIRCRSVSKRFNSLATQSESLLLQLDQILGATESDS
EIDSPIASFFRSLFKSIHGLLPPIFSKPANSDEILTRSPKTPAQILSGFERIRNLEVELY
GGDVKLEKGAAVKWKAEFGKTLKSCVIVAFRSATVNTSAATEAAAVVDGVVESDSEFVCG
LKTRVVWTISALMAASTRHYLMRDLVKDHKEMEKLIVRDSDGEGTVVMDAAGMKEYRETE
VRGDNKESERVGERTVVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPTGVASDDNDVEL
VTEAFAGDGDDCMYGEAVTALLKRRRNVLEMNSF

www.000webhost.com

Other information
Ka divergence:-0.0206188KaKs divergence:0.899739
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):945Length 2 (bp):1005Length divergence:0.031
MFE 1 (kcal):-314.94MFE 2 (kcal):-361.8MFE divergence0.069