Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22230-AT1G78110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6323303242058
Log2 mRNA fold difference:2.1244627897727
Log2 TE fold difference:-0.43320973012317
Sequences
Protein sequence

MIKGGGGKSSGYSADLMVCFPSRAHLSLPSKSISSPSSSFNRRQNAPHHRRSISKLSSSG
GGVRQNRGGGREVVEEPTSPKVTCAGQIKVRSSKRDGGGKNWQSLMAEIEKIHRSKSESK
FFGIKRDVMGFLTCLRDFDFRCFGAFPPVDIISDDEEEDEEEEEEDEEEDEDESSGTVFS
KWLMVLHEKQNNEECVDGKENVFSDVETAVPPPNALLLMRCRSAPVKNWSEEKKEETEEG
DNRVKQSGEEEEEEKDRVGNKKDLRSLMEEEKKMNLVVMNYDTNYYKLSNDIAKETWVVG
GIQDPLFRSRSWKK

MIKGNNGNRGSSSSGYSADLLVCFPSRTHLALTPKPICSPSRPSDSSTNRRPHHRRQLSK
LSGGGGGGHGSPVLWAKQASSKNMGGDEIAEPTSPKVTCAGQIKVRPSKCGGRGKNWQSV
MEEIERIHDNRSQSKFFGLKKDVMGFLTCLRNIKFDFRCFGDFRHADVTSDDDEEEDDDD
DEEEEVVEGEEEENSKTVFSKWFMVLQEEQNNKDDDKNNNKCDEKRDLEDTETEPAVPPP
NALLLMRCRSAPAKSWLEERMKVKTEQEKREEQKEEKETEDQETSMKTKKKDLRSLMEEE
KMELVLMRYDTEFYRLSSDIAKETWVVGGIQDPLSRSRSWKN

www.000webhost.com

Other information
Ka divergence:-0.180654KaKs divergence:-0.0491368
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):945Length 2 (bp):1029Length divergence:0.043
MFE 1 (kcal):-275.27MFE 2 (kcal):-305.6MFE divergence0.052