Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22250-AT1G78170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.9784561197039
Log2 mRNA fold difference:2.1760788717628
Log2 TE fold difference:-0.19767890297134
Sequences
Protein sequence

MFSPHDGTLCSKKRDHMKVFGESFHGSFKRSKQGDQKQTKFEKNTTTLFFQRSKSDSAML
IKPDVQLHLEAKTQSETFEDHRTDLDLNLNLYSSSSSSVKKTIMEKDECSKGGTVIISPS
KKVRSGDIGLSRSPSWLAFEGDDDDNQKKQEMITTVCMKCHMLVMLCKSTLVCPNCKFMH
HDDHSSTKQFQTLNLFKLLC

MVSRQEGTLYSRKRDFTVCGEEFHNSFKKSKQEDQSQSTLFNERPKSESMRSITFDFELH
LHTPLPSDWQTKGYSRTSDEHRAYPKDPVIFGQPKMSLDLELNLSPSGSPSRTTTKKYES
SSIHNETVSSSKIKVLTNTSKKSIIGTGLSRSPSWLAFEGGDDNDVDHKGQEMVTTVCMK
CHMLVMLCTSTPVCPNCKFMHPHDHSSTKLFKPSNLLRLLC

www.000webhost.com

Other information
Ka divergence:-0.285923KaKs divergence:-0.495935
GC content 1 (%):39GC content 2 (%):41GC content divergence:0.025
Length 1 (bp):603Length 2 (bp):666Length divergence:0.05
MFE 1 (kcal):-155.1MFE 2 (kcal):-171.7MFE divergence0.051