Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22270-AT1G78190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Trm112p-like protein
Function (paralog2):Trm112p-like protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.2068864990369
Log2 mRNA fold difference:-3.6210838072537
Log2 TE fold difference:1.4059133234233
Sequences
Protein sequence

MRLITHNMLSCNIKGVTSGFPLRIEAGNVIEKEVDFNPDFIRHMFAKIEWKALVEGARSM
GYAELPEESPDAAVLKSDEPFLKKLHHALLELHLEEGALVCPETGRKFPVNKGIPNMLLH
EDEV

MRLIVHNMLSCNIKGVVNKFPLRIEAEKVTVKEVDFNPDFLRYMFAKIDWKALVDGARSM
EYTELPDNAPDTTTLESDETFLRKFHHALLELHLEEGSLVCPETGRKFSVSKGIPNMLLH
EDEV

Other information
Ka divergence:0.0866436KaKs divergence:0.999916
GC content 1 (%):50GC content 2 (%):45GC content divergence:-0.053
Length 1 (bp):375Length 2 (bp):375Length divergence:0
MFE 1 (kcal):-120.4MFE 2 (kcal):-106.5MFE divergence-0.061