Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22280-AT1G78200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phytochrome-associated protein phosphatase type 2C
Function (paralog2):Protein phosphatase 2C family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.349959978088
Log2 mRNA fold difference:-0.44939742526467
Log2 TE fold difference:-0.90543813834879
Sequences
Protein sequence

MGKFCCFTSASEVVGGQSSSRSGKGRSDEGMIKYGFSLVKGKANHPMEDYHVANFINIQD
HELGLFAIYDGHMGDSVPAYLQKRLFSNILKEVKTKKKGEFWVDPRRSIAKAYEKTDQAI
LSNSSDLGRGGSTAVTAILINGRKLWIANVGDSRAVLSHGGAITQMSTDHEPRTERSSIE
DRGGFVSNLPGDVPRVNGQLAVSRAFGDKGLKTHLSSEPDIKEATVDSQTDVLLLASDGI
WKVMTNEEAMEIARRVKDPQKAAKELTAEALRRESKDDISCVVVRFR

MPKICCSRSATQVVVAQKSNSGKGRNGEGGIKYGFSLIKGKSNHSMEDYHVAKFTNFNGN
ELGLFAIFDGHKGDHVAAYLQKHLFSNILKDGEFLVDPRRAIAKAYENTDQKILADNRTD
LESGGSTAVTAILINGKALWIANVGDSRAIVSSRGKAKQMSVDHDPDDDTERSMIESKGG
FVTNRPGDVPRVNGLLAVSRVFGDKNLKAYLNSEPEIKDVTIDSHTDFLILASDGISKVM
SNQEAVDVAKKLKDPKEAARQVVAEALKRNSKDDISCIVVRFR

www.000webhost.com

Other information
Ka divergence:0.516866KaKs divergence:0.23267
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):864Length 2 (bp):852Length divergence:-0.007
MFE 1 (kcal):-248.3MFE 2 (kcal):-236.66MFE divergence-0.024