Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22330-AT1G78260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.1550078319296
Log2 mRNA fold difference:0.67851313289678
Log2 TE fold difference:-0.8381495383967
Sequences
Protein sequence

MSNTSYYRSPFGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGY
GFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRPSTPRGRGQGGSPSQYQGGGQS
SYTGMAAPVQQAAAAQLMYPSYGYTYNSEYGYHQALYNAQLQQAQYYQQQMYGGGGATSP
SSSNIMPSPYYYLQAPSPRPYLHHQQHYQYHHHQQQQQQQQQRLPSASSYLIYPSNVEAP
TPSNVPTSQGPLSSSTESHAPQQVSEEGGEFDPTDAPESTTTNIRDLTSSS

MSQTSYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGY
GFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPPRGRGQTGSPSQYQSGGPS
TYTGMAAPLPPAAAPQLMYPSYGYTYNPDQFGYHQALYNTQLQQAQYYQQQQQLYGGGAT
SPSSSGATIMPSPYYYGYSLQAPRVPYQHHHHLPQPYNPQQHHHQRFSSPSFLVYPSNSS
FAPPLQGVLSSSTESEAVPQQVPAAEGEATTTAPEITTSNTKEPISS

www.000webhost.com

Other information
Ka divergence:-0.443246KaKs divergence:-0.905536
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):876Length 2 (bp):864Length divergence:-0.007
MFE 1 (kcal):-243.97MFE 2 (kcal):-239.9MFE divergence-0.008