Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22340-AT1G78270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-glucosyl transferase 85A7
Function (paralog2):UDP-glucosyl transferase 85A4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9138167534258
Log2 mRNA fold difference:0.47215093698278
Log2 TE fold difference:1.2085313431199
Sequences
Protein sequence

MESHVVHNAQKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGP
NALDGFPSFRFESIPDGLPETDGDRTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPV
SCIVSDGVMSFTLDAAEELGVPEVIFWTNSACGFMTILHFYLFIEKGLSPFKDESYMSKE
HLDTVIDWIPSMKNLRLKDIPSYIRTTNPDNIMLNFLIREVERSKRASAIILNTFDELEH
DVIQSMQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWLDTKTPNSVL
FVNFGCITVMSAKQLEEFAWGLAASRKEFLWVIRPNLVVGEAMVVLPQEFLAETIDRRML
ASWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGVG
IEIGKDVKREEVETVVRELMDGEKGKKLREKAEEWRRLAEEATRYKHGSSVMNLETLIHK
VFLENLR

MEQHGGSSSQKPHAMCIPYPAQGHINPMLKLAKLLHARGFHVTFVNTDYNHRRILQSRGP
HALNGLPSFRFETIPDGLPWTDVDAKQDMLKLIDSTINNCLAPFKDLILRLNSGSDIPPV
SCIISDASMSFTIDAAEELKIPVVLLWTNSATALILYLHYQKLIEKEIIPLKDSSDLKKH
LETEIDWIPSMKKIKLKDFPDFVTTTNPQDPMISFILHVTGRIKRASAIFINTFEKLEHN
VLLSLRSLLPQIYSVGPFQILENREIDKNSEIRKLGLNLWEEETESLDWLDTKAEKAVIY
VNFGSLTVLTSEQILEFAWGLARSGKEFLWVVRSGMVDGDDSILPAEFLSETKNRGMLIK
GWCSQEKVLSHPAIGGFLTHCGWNSTLESLYAGVPMICWPFFADQLTNRKFCCEDWGIGM
EIGEEVKRERVETVVKELMDGEKGKRLREKVVEWRRLAEEASAPPLGSSYVNFETVVNKV
LTCHTIRST

www.000webhost.com

Other information
Ka divergence:0.187421KaKs divergence:0.218671
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1464Length 2 (bp):1470Length divergence:0.002
MFE 1 (kcal):-445.4MFE 2 (kcal):-470.52MFE divergence0.027