Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22430-AT1G22440
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GroES-like zinc-binding dehydrogenase family protein
Function (paralog2):Zinc-binding alcohol dehydrogenase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.40475951898562
Log2 mRNA fold difference:0.13568729702972
Log2 TE fold difference:0.29069288195299
Sequences
Protein sequence

MDKTFFSSNEGKPITCKAAICRKAGEALVIEDIHVDPPQAYEVRIKILCTSLCHTDLTFW
KLSFGPISRFPRILGHEAVGVVESIGENVDGFKQGDVVLPVFHPYCEECKDCKSSKTNWC
DRYAEDFISNTRRYGMASRFKDSSGEVIHHFLFVSSFSEYTVVDIAHLVKISPEIPVDKA
ALLSCGVSTGIGAAWKVANVEEGSTIAIFGLGAVGLAVAEGARLRGAAKIIGIDTNSDKF
ELGKKFGFTDFINPTLCGEKKISEVIKEMTEGGVDYSFECVGLASLLNEAFISTRTGTGK
TVMLGMEKHAAPISLGSFDLLRGRVICGSLFGGLKSKLDIPILVDHYLKKELNLDSFITH
ELNFKEINKAFALLEEGKSLRCILWMDK

MDKASITEGKPIRCKAAILRKAGEPLVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKL
DSGPLARFPRILGHEAVGVVESIGEKVDGFKQGDVVLPVFHPQCEECKECISPKSNWCTK
YTNDYLSNTRRYGMTSRFKDSRGEDIHHFIFVSSFTEYTVVDIAHLVKISPEIPVDIAAL
LSCSVATGLGAAWKVADVEEGSTVVIFGLGAVGLAVAEGVRLRGAAKIIGVDLNPAKFEI
GKRFGITDFVNPALCGEKTISEVIREMTDVGADYSFECIGLASLMEEAFKSTRPGSGKTI
VLGMEQKALPISLGSYDLLRGRTVCGTLFGGLKPKLDIPILVDRYLKKELNLEDLITHEL
SFEEINKAFHLLAEGNSIRCIIWMDK

www.000webhost.com

Other information
Ka divergence:-0.0139217KaKs divergence:0.0955267
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1167Length 2 (bp):1161Length divergence:-0.003
MFE 1 (kcal):-344.9MFE 2 (kcal):-330.64MFE divergence-0.021