Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22500-AT1G72200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.49389029112312
Log2 mRNA fold difference:-0.32640129562889
Log2 TE fold difference:-0.1735577671024
Sequences
Protein sequence

MVVMSRVSFYSSFLLLLLEVVVASSEFDDEGRTSFSPTTAIIMIVLVSVFFALGCISVYM
RRCLQHALGMDSGGGPGNWLNVRQTTEPGLDASVIETFPTFPYSTVKTLRIGKEALECPV
CLNEFEDDETLRLIPQCCHVFHPGCIDAWLRSQTTCPLCRANLVPVPGESVSSEIPGLAR
ETGQNSLRTPIDDNRKRVLTSPDERLIDSVAWTGNQSMPRKSMSTGWKLAELYSPASSPG
QPEENLDRYTLRLPQEIHDQLVNSSLGKQGSKGQLALPQERSSVRGFRTGSLGTEKNYFY
FERFDQDGRLDRRPFSITPPYHTRSIQSPDEIINASGNYQDRAGAPKGLLLAIRSPFDRL
FTGKKNAGERSYLQSGDASPV

MNPKGRTNLNRSIIGGHDHGSILQLLLFLLLLSSHGGFKFVAGQATHGGSDVSGDSSRFD
PTMAILMIVLVSVFFFLGFFSVYIRRCLERVMGMDYGNPNDAGNWLATNRQQARGLDASI
IETFPTFQYSTVKTLRIGKEALECSVCLNEFEDDETLRLIPKCCHVFHPGCIDAWLRSHT
TCPLCRADLIPVPGESIVSIQIPGLVNDPPGSDPNGDRIRSLGSPDARLIESVALTCNQS
MPRRSMSTGWNLAGMFTNSDRTGQHSENLDRFTLRLPQDIHNKLVNPNLSKVHVALPQVM
SSTRGYRTGSLGSERNYFYYERFDQDGRLDRRPFSITPPYRTSSINHMSPGGSGGDKVRA
SSPKSLLLAMRSPFDRLFLGKNNNVGENSSDHLRSCDATPSNTV

www.000webhost.com

Other information
Ka divergence:-0.274672KaKs divergence:0.54748
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1146Length 2 (bp):1215Length divergence:0.029
MFE 1 (kcal):-387.63MFE 2 (kcal):-376.55MFE divergence-0.014