Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22510-AT1G72175
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box protein with domain of unknown function (DUF 1232)
Function (paralog2):RING/U-box protein with domain of unknown function (DUF 1232)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.20871932439366
Log2 mRNA fold difference:-0.40620440842309
Log2 TE fold difference:0.52196650921741
Sequences
Protein sequence

MRHRRTNFVRYAMATSTLLANPIALTGSAVRSPSYLLSFLLLSNRFGIGNCIMLVWRHGS
TLRPCKCPLCRRPISLLVPSEETVRSRNDATVSEVLHDVETYNRVFGGQSSGLIQRMQDL
PFLLRRLLREMMDPQRTLPLVIRARVYIALILSAIYIISPIDIIPEGVLGVIGLLDDLLI
ALICFLHVAALYRSVLYSRHGGS

MNSPPENDLCSICHSHFTAPCQANCSHWFCGNCIMLVWRHGSTLQPCKCPLCRRHISLLV
PSEDTIRDRNDATVKEVLGNLETYNRLFGGRSSSLVQRMQDLPFLLRRLLREMMDPQRTL
PLVIRARVYIAMILSAVYIISPIDIIPEGVLGVVGLLDDLLIALICFLHVAALYRSVLYF
RHAGS

Other information
Ka divergence:-0.364787KaKs divergence:-0.496615
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):612Length 2 (bp):558Length divergence:-0.046
MFE 1 (kcal):-182.45MFE 2 (kcal):-155.74MFE divergence-0.079