Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22520-AT1G72170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Domain of unknown function (DUF543)
Function (paralog2):Domain of unknown function (DUF543)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.2875541299846
Log2 mRNA fold difference:0.33011922039877
Log2 TE fold difference:-1.6605220488713
Sequences
Protein sequence

METTKSNSSESDVNAKWDACLDLTARRFVYSSLGGAFAGLLFFRSPVTRWASIAFGAGIG
IGSAYTDCSRVFDASSSTSATLLAAPKSTETSVSQVSRNLLRGKYDLEEWQQKSEDNEEA
WSVVLYTDVKIVNDPLIFFVLKNLMFFYLRNNSSGLICLPLLFLHSSNNLLTYRLSYRF

MAEKKDSVPPEYDVNAKWDACLDLTVRRFVYSSLGGAFAGLLFFRSPVTRWASIALGAGI
GIGSAYSDCSRAFDSPSSSSANLAAPKNNITETSPVSQAADE

www.000webhost.com

Other information
Ka divergence:-0.0680736KaKs divergence:-0.895429
GC content 1 (%):42GC content 2 (%):47GC content divergence:0.056
Length 1 (bp):540Length 2 (bp):309Length divergence:-0.272
MFE 1 (kcal):-152.8MFE 2 (kcal):-85.01MFE divergence-0.285