Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22540-AT1G22550
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.51507474115138
Log2 mRNA fold difference:0.9655577873689
Log2 TE fold difference:-0.46023140673751
Sequences
Protein sequence

MSISGAVDEAGTPLLAVTVDYRNKPAVKSSSGGWRSAGFIIGVEVAERFAYYGISSNLIT
YLTGPLGQSTAAAAANVNAWSGTASLLPLLGAFVADSFLGRFRTILAASALYIVGLGVLT
LSAMIPSDCKVSNLLSSCSPRFQVITFFSALYLVALAQGGHKPCVQAFGADQFDEKEPEE
CKAKSSFFNWWYFGMCFGTLTTLWVLNYIQDNLSWALGFGIPCIAMVVALVVLLLGTCTY
RFSIRREDQSPFVRIGNVYVAAVKNWSVSALDVAAAEERLGLVSCSSSQQFSFLNKALVA
KNGSCSIDELEEAKSVLRLAPIWLTCLVYAVVFAQSPTFFTKQGATMERSITPGYKISPA
TLQSFISLSIVIFIPIYDRVLIPIARSFTHKPGGITMLQRIGTGIFLSFLAMVVAALVEM
KRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGITDVFAMVGLQEFFYDQVPNELRSVG
LALYLSIFGIGNFLSSFMISIIEKATSQSGQASWFANNLNQAHLDYFYWLLACLSFIGLA
SYLYVAKSYVSKRLDTS

MAIAEEEAALIEDSVSDSVDHRGLPAGKSSTGGWRSAWYIIGVEVGERFAYFGIGSNLIT
YLTGPLGQSTATAAVNVNTWSGTASILPVLGAFIADAYLGRYRTIVVASLIYILGLGLLT
LSSILILMGLSEQRQHNRNASAKPFFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDV
GDPKERISRGSFFNWWFLSLSAGITLSIIVVVYVQDNVNWALGFGIPCLFMVMALALFLF
GRKTYRYPRGDREGKNNAFARIGRVFLVAFKNRKLKLTHSGQLEVGSYKKCKGQLEFLAK
ALLPGEGGVEPCSSRDVEDAMALVRLIPIWITSVVSTIPYAQYATFFTKQGVTVDRKILP
GFEIPPASFQALIGLSIFISVPTYERVFLPLARLITKKPSGITMLQRIGAGMVLSSLNMV
VAALVEMKRLETAKEHGLVDRPDATIPMSIWWFVPQYLLLGMIDVFSLVGTQEFFYDQVP
TELRSIGLALSLSAMGLASFLSGFLITVINWATGKNGGDSWFNTNLNRAHVDYFYWLLAA
FTAIGFLAFLLLSRLYVYRRVDQV

www.000webhost.com

Other information
Ka divergence:0.40219KaKs divergence:-0.978797
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1674Length 2 (bp):1695Length divergence:0.006
MFE 1 (kcal):-533.43MFE 2 (kcal):-537.84MFE divergence0.004