Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22600-AT1G72100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Late embryogenesis abundant protein (LEA) family protein
Function (paralog2):late embryogenesis abundant domain-containing protein / LEA domain-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.61353718758866
Log2 mRNA fold difference:1.4777166059087
Log2 TE fold difference:-1.0087689454304
Sequences
Protein sequence

MTKLLALSLVLSALFTVGHCTGSEDDIIVRDGHRVVVVEYDRDGETNTRVLISPPGKEVD
QKSRDEGEVFGNEKRETASSLPEEEEREHHATPGELICDAIGKCKHKLGTVLGRVKDRTA
SDLSDETPEMTVAREALEVEEKVSWKAREARGKVNERATKKAHRVQKVLEKVQIAVRGIG
TVVATALGLTKIGSVVGIVGIAAAYGMCVWVTFVSGYVLASVLGEQQFGVVQSKMYPVYF
KAVSVGILVGLLGHVIGRRRKVFTDAVDMWQSVNLLSSILMVEANASFVYTRATKAMFEL
IKAEKEDGRGFDTSDQSQSSESAGRTRGKKKVTEKTDEDVVKQRLTKLSERMRKLNAYSS
RLNLLTLMSLTWHFVYLGYRLSLTC

MTNLLALCLVLSTLLAAEVWSPSPAMTTHNTAVASEGEVIVKDGHHVVVVEYDRDGKTNT
RVSISPPSADQGEEKENEVEMGTSMFRNVKEKAKETASYLPHVGQGISQPVMTDEARDHH
ATAGEVICDAFGKCRQKIASVVGRAKDRTVDSVGETASDVREAAAHKAHDVKETVTHAAR
DVEDTVADQAQYAKGRVTEKAHDPKEGVAHKAHDAKESVADKAHDAKESVAQKAHDAKEK
VREKAHDVKETVAQKAHESKERAKDRVREKAQELKETATHKSKNAWERVKNGAREFGSAT
AATLSPTKVASIVGLTGIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT
SVGILVGLFGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKA
EKEEGRGGERTSEQELRRKLEQLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGAAC

www.000webhost.com

Other information
Ka divergence:-0.143145KaKs divergence:-0.625604
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1158Length 2 (bp):1443Length divergence:0.11
MFE 1 (kcal):-376.1MFE 2 (kcal):-509.7MFE divergence0.151