Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22680-AT1G71970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.6317060344691
Log2 mRNA fold difference:3.4139661394575
Log2 TE fold difference:-0.7901559392172
Sequences
Protein sequence

MDTSPRTRIVPTRRSNSVKFSSTVNISTRRSLSSSSSNSLLFSGNSPATPLHPLGIPFSW
EKLPGKPKEFSYHRKNESLSNLLPLPPHWSNHSPNTRCKKNTSPAAMRDPFMAALVECSK
GATTDGEHTGGESRKVLRKSRSIGLLNLYSSCRRACEVSESIVYLPKSIASYDHLHLSTR
GRRRR

MDSLRTRNVSKRSDPINFPAKSSISSRRSLSSSSSFSSFSSCSSSSLVFPGDSPLNSPAT
PLRLLGVPFSWEQLPGKPKDYSHRLNNRRNNESSNLLLPLPPHRNISFPATGKKPKPNNS
SKKNSFPVTGKDPFAAALLECSKDEGTNSDNDDDVDGVEDVDRRFRGNSGGSSKVLSKNS
IGDRFGLVNLYGSCRRTCAVTESIVYLPRARKAASYDNLLPRRRC

www.000webhost.com

Other information
Ka divergence:0.0520578KaKs divergence:-0.273471
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):558Length 2 (bp):678Length divergence:0.097
MFE 1 (kcal):-159.7MFE 2 (kcal):-180.33MFE divergence0.061