Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22710-AT1G71890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sucrose-proton symporter 2
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.6906826947566
Log2 mRNA fold difference:-5.5936228643032
Log2 TE fold difference:0.85269843713933
Sequences
Protein sequence

MVSHPMEKAANGASALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLL
GIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYA
ADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTAN
AFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVS
LCYVKEKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFD
TDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMSLGVEWIGRKLGGA
KRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQAI
TFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFVLG
AIAAAVSGVLALTVLPSPPPDAPAFKATMGFH

MGALEAERAANNATALETQSSPEDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYIQ
LLGIPHKWSSYMWLCGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIG
FAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRV
ANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTF
SSLWYVKDKQWSPPQGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWFPFI
LYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLGVESIGRKMGG
AKRLWGCVNFILAIGLAMTVLVTKSAEHHREIAGPLAGPSSGIKAGVFSLFTVLGIPLAI
TYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLPSFVVG
AIAAAVSGVLALTVLPSPPPDAPAMSGAMGFH

www.000webhost.com

Other information
Ka divergence:0.314796KaKs divergence:0.046875
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):1539Length 2 (bp):1539Length divergence:0
MFE 1 (kcal):-533.68MFE 2 (kcal):-494.6MFE divergence-0.038