Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22830-AT1G71490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.069299039316229
Log2 mRNA fold difference:-1.3183973626223
Log2 TE fold difference:1.2798926127445
Sequences
Protein sequence

MPSSPSRSILRGLTVSEICKFIPQSWKQLPRPISETSKTHDDESVPQVLFNSFRHCISHG
QLYEAFRTFSLLRYQSGSHEFVLYSSASLLSTCVGFNEFVPGQQLHAHCISSGLEFDSVL
VPKLVTFYSAFNLLDEAQTITENSEILHPLPWNVLIGSYIRNKRFQESVSVYKRMMSKGI
RADEFTYPSVIKACAALLDFAYGRVVHGSIEVSSHRCNLYVCNALISMYKRFGKVDVARR
LFDRMSERDAVSWNAIINCYTSEEKLGEAFKLLDRMYLSGVEASIVTWNTIAGGCLEAGN
YIGALNCVVGMRNCNVRIGSVAMINGLKACSHIGALKWGKVFHCLVIRSCSFSHDIDNVR
NSLITMYSRCSDLRHAFIVFQQVEANSLSTWNSIISGFAYNERSEETSFLLKEMLLSGFH
PNHITLASILPLFARVGNLQHGKEFHCYILRRQSYKDCLILWNSLVDMYAKSGEIIAAKR
VFDSMRKRDKVTYTSLIDGYGRLGKGEVALAWFKDMDRSGIKPDHVTMVAVLSACSHSNL
VREGHWLFTKMEHVFGIRLRLEHYSCMVDLYCRAGYLDKARDIFHTIPYEPSSAMCATLL
KACLIHGNTNIGEWAADKLLLETKPEHLGHYMLLADMYAVTGSWSKLVTVKTLLSDLGVQ
KAHEFALMETDSELDGENNKPMNDDSVINQEQSSDEERLVEVG

MLSESLFKSLGHLASHGHLHDAFKTFSLLRLQSSSAVSDDLVLHSAASLLSACVDVRAFL
AGVQVHAHCISSGVEYHSVLVPKLVTFYSAFNLHNEAQSIIENSDILHPLPWNVLIASYA
KNELFEEVIAAYKRMVSKGIRPDAFTYPSVLKACGETLDVAFGRVVHGSIEVSSYKSSLY
VCNALISMYKRFRNMGIARRLFDRMFERDAVSWNAVINCYASEGMWSEAFELFDKMWFSG
VEVSVITWNIISGGCLQTGNYVGALGLISRMRNFPTSLDPVAMIIGLKACSLIGAIRLGK
EIHGLAIHSSYDGIDNVRNTLITMYSKCKDLRHALIVFRQTEENSLCTWNSIISGYAQLN
KSEEASHLLREMLVAGFQPNSITLASILPLCARIANLQHGKEFHCYILRRKCFKDYTMLW
NSLVDVYAKSGKIVAAKQVSDLMSKRDEVTYTSLIDGYGNQGEGGVALALFKEMTRSGIK
PDHVTVVAVLSACSHSKLVHEGERLFMKMQCEYGIRPCLQHFSCMVDLYGRAGFLAKAKD
IIHNMPYKPSGATWATLLNACHIHGNTQIGKWAAEKLLEMKPENPGYYVLIANMYAAAGS
WSKLAEVRTIMRDLGVKKDPGCAWIDTDSGFSLFSVGDTSSPEACNTYPLLDGLNQLMKD
NAGYAINKVQSSDEELLQEMG

www.000webhost.com

Other information
Ka divergence:-0.229644KaKs divergence:-0.0733117
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):2112Length 2 (bp):2046Length divergence:-0.016
MFE 1 (kcal):-627.3MFE 2 (kcal):-625.88MFE divergence-0.001