Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22870-AT1G71410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase family protein with ARM repeat domain
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8097033518635
Log2 mRNA fold difference:2.4708685960662
Log2 TE fold difference:-0.65513023330911
Sequences
Protein sequence

MSINMRTLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSGGPGLAWKLYSAK
ARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDAFLDLIRADSGKLVRLRHPGVV
HVVQALDENKNAMAMVTEPLFASVANALGNVENVDNVPKDLKSMEMSLLEVKHGLLQIAE
TLNFLHNNAHLIHRAVSPENVFITSAGSWKLAGFGFAISQAQDGNLDNLQSFHYSEYDVE
DSILPLQPSLNYTAPELVRSKTSSAGVSSDIFSFGCLTYHLVARKPLFDCHNNVKMYMNT
LNYLTNETFSSIPSDLVSDLQRMLSMNESYRPTALDFTGSSFFRSDTRLRALRFLDHMLE
RDNMQKSEFLKALSDMWKDFDSRVLRYKVLPPLCAELRNLVMQPVILPMVLTIAESQDKN
DFELTTLPALVPVLSTATGDTLLLLIKRAELIINKTNAEHLVSHVLPLLLRAYNDNDVRI
QEEVLKRSTSVAKQLDGQVVRQAILPRVHGLALKTTVAAVRVNALLCLAELVQTLDKLAV
TEILQTIQRCTAVDRSAPTLMCTLAIANAILKQYGVEFTSEHVLPLIIPLLTAQQLNVQQ
FAKYILFVKDILRKIEEKRGVTVNDSGVPEVKPGCVADGLQFQTPTKKTEKVASAAKNSP
AWDEDWALPTKISAPRDPGPANSPQFNNSTVQSQSSNRTSVPTTCPAVDLEWPPRQSFNA
TAQPANDETRINAAGTPTTPSFDELDPFANWPPRPNSASTASGGFHNSTTTQPPINNSGS
GLRNNLTDGRQFQTTNNDFWAFGNASLSSMKSQQETSGIRASNADPLTSFGIQNQNQGMP
SFGSSSYGNQKPQADISSIFSSSRTEQSAMKLAPPPSIAVGRGRGRGRSGTSISKPNGSK
QQQTEQPSLLDLL

MSINMKTFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAAK
ARDSTRPQQYPTVCVWMLDKRALSEARVRANLSKAAEDAFLDLIRADAGKLVRLRHPGVV
HVVQALDENKNAMALVTEPLFASVANALGNVENVGNVPKDLKSMEMSLLEVKHGLLQISE
TLNFLHNNANLIHRAISPENVLITSAGSWKLAGFGFAISAAQAGNLDNMQSFHYSEYDVE
DSILPVQPSLNYTAPELMRSKSPSAGASSDIFSFGCLAYHLVARKPLFDCNNNVKMYMNT
LNYITNESFSSIPSELVSDLQRMLSTNESFRPTALDFTGSNFFRSDARLRALRFLDHLLE
RDNMQKSEFLKALSDMWKDFDSRVLRYKVLPPLCAELRNLVLQPIILPMVLTIAQSQDRT
DFELITLPALVPVLSTASGDTLLLLVKHADLITNKTDSEHLVSHVLPLLLRAYNDNDVRI
QEEVLKRSTSVAKQLDGQVVRQAILPRVHGLALKTTVAAVRVNALLCLAELVQTLDKPAA
IEILETIQRCTAVDRSAPTLMCTLAVANAILKQYGVEFTAEHVLTLMMPLLTAQQLNVQQ
FAKYMLFVKDILRKIEEKRGVTVNDSGVPEVKPHSAANGLQFQSSTQIPEKVASAAKSSP
AWDEDWGSPSKDSAVGNPASSRHNTNDQFNKSTDQSQPSIMSTLPNKTTAPTTCPAVDIE
WPPRQSSSLTAPATDNQTQLNTGTSFASGFDELDPFANWPPRPNNGASVASTGLKNGAAS
NFSNNLPGGTHFQTANNDNWAFSSASLSSLKPPQQGNQGISANNQDPLNSFGVPKQSQGM
PSFTSGSYNNQKPADISSIFGSSKTEPSAMKLAPPPSIAMGRGRGRGRGGTGTSTSKPSG
SQPSLLDLL

Other information
Ka divergence:-0.0373622KaKs divergence:-0.0106805
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):2742Length 2 (bp):2730Length divergence:-0.002
MFE 1 (kcal):-810.18MFE 2 (kcal):-822.15MFE divergence0.007