Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22880-AT1G71380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cellulase 5
Function (paralog2):cellulase 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.836340801419
Log2 mRNA fold difference:-3.5639229950529
Log2 TE fold difference:0.75776278070885
Sequences
Protein sequence

MASPFFFVFLLSALSLENTYASPNYREALSKSLLFFQGQRSGRLPSDQQLSWRSSSGLSD
GSSAHVDLTGGYYDAGDNVKFNFPMAFTTTMLSWSSLEYGKKMGPELQNSRVAIRWATDY
LLKCARATPGKLYVGVGDPNGDHKCWERPEDMDTPRTVYSVSPSNPGSDVAAETAAALAA
SSMVFRKVDPKYSRLLLATAKKVMQFAIQYRGAYSNSLSSSVCPFYCSYSGYKDELLWGA
AWLHRATNDPYYTNFIKSLGGGDQPDIFSWDNKYAGAYVLLSRRAVLNKDNNFELYKQAA
ENFMCKILPNSPSSSTKYTKGGLMYKLPQSNLQYVTSITFLLTTYAKYMKSTKQTFNCGN
SLIVPNALINLSKRQVDYVLGVNPMKMSYMVGFSSNFPKRIHHRGSSLPSRAVRSNSLGC
NGGFQSFRTQNPNPNILTGAIVGGPNQNDEYPDQRDDYTRSEPATYINAAFVGPLAYFAA
SRSP

MTSLFFFVLLFSSLLISNGDANPNYKEALSKSLLFFQGQRSGPLPRGQQISWRASSGLSD
GSAAHVDLTGGYYDAGDNVKFNLPMAFTTTMLSWSALEYGKRMGPELENARVNIRWATDY
LLKCARATPGKLYVGVGDPNVDHKCWERPEDMDTPRTVYSVSASNPGSDVAAETAAALAA
ASMVFRKVDSKYSRLLLATAKDVMQFAIQYQGAYSDSLSSSVCPFYCSYSGYKDELMWGA
SWLLRATNNPYYANFIKSLGGGDQPDIFSWDNKYAGAYVLLSRRALLNKDSNFEQYKQAA
ENFICKILPDSPSSSTQYTQGGLMYKLPQSNLQYVTSITFLLTTYAKYMKATKHTFNCGS
SVIVPNALISLSKRQVDYILGDNPIKMSYMVGFSSNFPKRIHHRASSLPSHALRSQSLGC
NGGFQSFYTQNPNPNILTGAIVGGPNQNDGYPDQRDDYSHAEPATYINAAFVGPLAYFAA
GRST

www.000webhost.com

Other information
Ka divergence:0.069539KaKs divergence:0.512433
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1455Length 2 (bp):1455Length divergence:0
MFE 1 (kcal):-423.15MFE 2 (kcal):-424.39MFE divergence0.001