Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22920-AT1G71230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):COP9 signalosome 5A
Function (paralog2):COP9-signalosome 5B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0302249798422
Log2 mRNA fold difference:-1.4386063282298
Log2 TE fold difference:-0.67259079881103
Sequences
Protein sequence

MEGSSSAIARKTWELENNILPVEPTDSASDSIFHYDDASQAKIQQEKPWASDPNYFKRVH
ISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQSDAYEY
MVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTV
SAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSH
LLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGGIAPAGHQRR
KEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMITS

MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWENDPHYFKRVK
ISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQDDAYEY
MVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTV
SAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSH
LLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKK
KEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMITY

www.000webhost.com

Other information
Ka divergence:0.0959869KaKs divergence:-0.150707
GC content 1 (%):48GC content 2 (%):43GC content divergence:-0.055
Length 1 (bp):1074Length 2 (bp):1077Length divergence:0.001
MFE 1 (kcal):-353.2MFE 2 (kcal):-313.34MFE divergence-0.06