Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22970-AT1G22980
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.2897038183526
Log2 mRNA fold difference:-4.3279054429094
Log2 TE fold difference:1.0174982560703
Sequences
Protein sequence

MVKTKKEDLNQFLIPRLNTIYETLQLFDGTASPTVERVNWNDVLQMSDHLSKQATIVGML
WTGESPKADSLKETMESYFNALQGFLLCCHGSTLGAGPTLSSIIHVSVKQIVDSSFRLLQ
GSVSLYEGSYEKDKKPSIPQLSGVVWEACSSFKKVPATNITAIGRAITQVAVSMKDVLRE
MKEVKPACPLSECEASGDNMSSDDDDDDDLGDDLSPEEMEVATMVTEIVSETIMVIKELI
RVITGMIKMENPKDNSGFVESLEKLLKLCQGTGVQIDELGACVYPPQEMNKMKQTVKVIQ
GNLDEFETEVERLKSSSDGFSGACGKLRNSLKHMETELDKRCEAELVVEMQNVTLDS

MGKSKKKVLNKSLITHPSTSDDTLQLFDPTSSPTKEKVNWNNVLGISDYLSKQATRVKTL
WTGETPKAESVKETMESYFKALLGFLLCCHGSTLGAGPTLSSIVHGSVKQIVDSSFRLFQ
GSVSLYDGSYEKGEKPSISQLSGAVLEACSSFKKVPTTNLIAIGSAISQVSVIMKDVLNE
MKKVKPACPSSEGEASGDDFSPEQIEVAKMVADIVYEAMTVIIVIRVITRMMEKENSNEN
SVFVESLEKLLKLCQRSGVVIEELGTCVYHPPLKIDKITQTVKILEGNLDEVEAQVEYMK
RSSNAFPGVCRKLRDAIKLMEVGLEKRKDLNQILISRQNTLYNALQLLDPTASPMNRCS

www.000webhost.com

Other information
Ka divergence:0.729253KaKs divergence:-0.0830409
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1074Length 2 (bp):1080Length divergence:0.003
MFE 1 (kcal):-313.1MFE 2 (kcal):-305.24MFE divergence-0.013