Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22990-AT1G71050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Heavy metal transport/detoxification superfamily protein
Function (paralog2):Heavy metal transport/detoxification superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.07125649463867
Log2 mRNA fold difference:0.78937297264499
Log2 TE fold difference:-1.3572858843316
Sequences
Protein sequence

MGALNYLSEYFSNHFYVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSIKGAKSVE
VNRKMHKVTVSGYVDPKKVLKTVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV
RKSEQAQAQPGSTDDKLMSLFSDENPNACTVM

MGALDSLSEYISDYFRVTRKRRKRKVMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVEV
NRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGYVRK
SEQSQLQLLPGAPENHYISLFSDENPNACTVM

www.000webhost.com

Other information
Ka divergence:-0.116599KaKs divergence:0.995964
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):459Length 2 (bp):459Length divergence:0
MFE 1 (kcal):-135.8MFE 2 (kcal):-134.76MFE divergence-0.004