Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23010-AT1G71040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cupredoxin superfamily protein
Function (paralog2):Cupredoxin superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.7630918967166
Log2 mRNA fold difference:2.5651324252946
Log2 TE fold difference:0.26854906726136
Sequences
Protein sequence

MESLLCRRRIKRVMVLIIALTWLRSTCGELEDQLFEVGKLKMFVDDLPDMPRLYGFNSVH
GIIKPASLQIGMFSTKWKFHRDLPATPVFAYGTSRSKATVPGPTIETVYGVDTYVTWRNH
LPKSHILPWDPTISPATPKHGGIPTVVHLHGGIHEPTSDGNADAWFTAGFRETGPKWTKT
TLHYENKQQPGNMWYHDHAMGLTRVNLLAGLVGAYILRHHAVESPFQLPTGDEFDRPLII
FDRSFRKDGSIYMNATGNNPSIHPQWQPEYFGDVIIVNGKAWPRLNVRRRKYRFRIINAS
NARFFKFFFSNGLDFIVVGSDSAYLSKPVMTKSILLSPSEIVDVVVDFYKSPSRTVVLAN
DAPYPYPSGDPVNEENGKVMKFIINNESEDDTCTIPKKLINYPNADVSNAVLTRYISMYE
YVSNSDEPTHLLVNGLPYEAPVTETPKSGTTEVWEVINLTEDNHPLHIHLGLFKVVEQTA
LLAAGLEEFKECMTKQNDAVKCQISKYARGKKTAVTAHERGWKNVFKMMPGHVTRILVRF
SYIHTNASYPFDPTQEPGYVYHCHILDHEDNMMMRPLKVII

MEPSRRRMTRDMLLLIVTMAWLVTGDEGGIKQEERLFNLGKLEMFVDKLPHIPTLHGYHF
VNGFLKPKSLHIGMFFKKWKFHRDLPATPVFAYGTSKRSATVPGPTIEAVYGVDTYVTWR
NHLPLHHILPWDPTISPAIPKHGGIPTVVHLHGGIHEPTSDGNADSWFTAGFKETGSKWT
KKTTHYVNKQQPGNMWYHDHAAGLTRVNLLAGLLGSYILRHSSVESPLRLPTGREFDRPL
VIFDRSFRKDGSIYMNATGNNPTIHPQWQPEYFGDAIIVNGKAWPRLTVRRRKYRFRITN
ASNARFFRFFFSNGLDFIVVGSDSAYLAKPVSTKSVLLAPSEIVDVLVDFSKSTSKTAIL
ANNAPYPYPSGDPVTEENSKVMKFIINYKSEVDTSIIPKKLIEYPPAHVSTSTRTRYIAM
FEYVSSIDEPTHLYINGLPYNAPVTETPKIGTSEVWEVINLTEDNHPLHIHLGLFKVLEQ
TALVKSEEFIECMTKRNDAVKCEISKYARGNKTAVTVHERGWKNVFKMMPGHVTKILVRF
SYIHSNESYSFDATQEPGYVYHCHILDHEDNMMMRPFAMVL

Other information
Ka divergence:-0.0219646KaKs divergence:-0.0364896
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1746Length 2 (bp):1746Length divergence:0
MFE 1 (kcal):-524.73MFE 2 (kcal):-515.25MFE divergence-0.009