Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23030-AT1G71020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.32395834226377
Log2 mRNA fold difference:0.28733078871415
Log2 TE fold difference:0.057767744334278
Sequences
Protein sequence

MAGGIVSPASLLDLIADIVEIPLNTGMFKKDCADLTRRVCLLTHLLEEIRDSTPIDSAAS
SSSENDWWSDLVVGLQAAKRLLSTARFQARDSSDGAAKRISFQFQCVTWKLEKALSNLPY
DLYDISDEVGEQVELARSQLRRAMQRYGSLNSNKFSSALSEPMERDGFSNVIKIKAEEKL
ESVSETLHFGEEEEKQSSPPLRRSSSISLAYYLSKDADTDRLDKMVNKNTDESKKSDKLT
IPVDFLCPVSLELMKDPVIVATGQTYERAYIQRWIDCGNLTCPKTQQKLENFTLTPNYVL
RSLISRWCAEHNIEQPAGYINGRTKNSGDMSVIRALVQRLSSRSTEDRRNAVSEIRSLSK
RSTDNRILIAEAGAIPVLVNLLTSEDVATQENAITCVLNLSIYENNKELIMFAGAVTSIV
QVLRAGTMEARENAAATLFSLSLADENKIIIGGSGAIPALVDLLENGTPRGKKDAATALF
NLCIYHGNKGRAVRAGIVTALVKMLSDSTRHRMVDEALTILSVLANNQDAKSAIVKANTL
PALIGILQTDQTRNRENAAAILLSLCKRDTEKLITIGRLGAVVPLMDLSKNGTERGKRKA
ISLLELLRKACQ

MAGGAITPDSLIGLIAEINEIPGNFGLFKKDCSDLARRVGLLTHLIEEIRDSSPPSESDA
SSSLNSHECDWWSDLVVGLQAAKRLLSSATSFQARESSDGAAKRISFQFQCVTWKLEKAL
GDLTYDRYDISDEVREQVELARLQLRRAMQRYGSLNSKKFSSGLSEPMEKDASSNRKVIE
KLESIPETVHSLSDEKKFESPPPWKSSSVSLAFFLSKDGDDERLEKAVTENSDDSQKSDN
LTIPEDFLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKLENFTLTPNY
VLRSLISQWCTKHNIEQPGGYMNGRTKNSDGSFRDLSGDMSAIRALVCKLSSQSIEDRRT
AVSEIRSLSKRSTDNRILIAEAGAIPVLVKLLTSDGDTETQENAVTCILNLSIYEHNKEL
IMLAGAVTSIVLVLRAGSMEARENAAATLFSLSLADENKIIIGASGAIMALVDLLQYGSV
RGKKDAATALFNLCIYQGNKGRAVRAGIVKPLVKMLTDSSSERMADEALTILSVLASNQV
AKTAILRANAIPPLIDCLQKDQPRNRENAAAILLCLCKRDTEKLISIGRLGAVVPLMELS
RDGTERAKRKANSLLELLRKSSRKLGSL

Other information
Ka divergence:-0.0381114KaKs divergence:0.0567402
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1839Length 2 (bp):1887Length divergence:0.013
MFE 1 (kcal):-575.7MFE 2 (kcal):-589.51MFE divergence0.012