Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23060-AT1G70950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):TPX2 (targeting protein for Xklp2) protein family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.74904306733978
Log2 mRNA fold difference:0.51267456935661
Log2 TE fold difference:0.19666226415129
Sequences
Protein sequence

MAGEVQDPFNLSLLENSIHSGSVSFGRFEKESLSWERRSSFSRNIYLEEAERFSKPGSVT
QMRAHFEAHFKKKGIRFPSSVESQTWGEVVHHQTCTEKDENLWENTSQFGDSCVSFDETI
LVNSDDDVHTSISVALERTDIGRIEDEKETKSSSSATRSKPLKNVQKARPYSATNKDSTK
KHVVIPKGYSPSSNAKTSVDTKRQKELKPKRIVETVACQAPATSKKTEILTPLLATREKK
TSTNGFSLRSNERAEKKKEEKVEAVVRKALNLKARPLPKSTQARPQHTSTGQAKAKAKAR
DDHSSTASCDRSLTNRMAKSKVIINKQKADMQRSLNGIRPKTSDQTARNSTNIRSLAVRR
SAVQVAL

MAGEIQDPFSLSFQGNSIHSGSISFGRFEKEGLSWEKRSSFSHNRYLEEVDKCSKPGSVT
EMKAHFEAHFKKKGIRFPASLESQTWGVHQTSNEPDDEAVHATESFEDYRSDGSFSEDTS
QSNSVCNYSHEQEKCGQGKSQCEFDEESDHCVSYDEILVNSDEVIELDEEEGGGDHGRVA
DLVECENLGPPEMPQEIVIQDSALVEEAGSKLDEHASKKPSNSMETPSSSVNVKPIIPND
VRVTKASTKGHDVTPKAASRRTKGSSLSSNSKTNVDAKSQKELRPKKTIESQPKSSNKTE
TRPPIATNRCKTSTTSSKLEMSTGSTSFRFKCSERAEKRKEFYMKLEEKIHAKKTETNQV
QAKTQQKAEAEIKQFRKSLNFKATPMPSFYNIGTRPVSHNKTEPSKVAQSRSRPATSASI
TNRAVTRVSYKHGFEEAEMVKVMVSNRKQSAAKDSDLQKGNLMAVEMKQQIGARRSRN

www.000webhost.com

Other information
Ka divergence:-0.266738KaKs divergence:0.232505
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1104Length 2 (bp):1437Length divergence:0.131
MFE 1 (kcal):-306.89MFE 2 (kcal):-388.31MFE divergence0.117