Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23080-AT1G70940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Auxin efflux carrier family protein
Function (paralog2):Auxin efflux carrier family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.56580585642506
Log2 mRNA fold difference:-0.080297179446419
Log2 TE fold difference:0.70738950074811
Sequences
Protein sequence

MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS
SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL
LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD
VVSLDGHDFLETDAQIGDDGKLHVTVRKSNASRRSFYGGGGTNMTPRPSNLTGAEIYSLN
TTPRGSNFNHSDFYSMMGFPGGRLSNFGPADMYSVQSSRGPTPRPSNFEESCAMASSPRF
GYYPGGAPGSYPAPNPEFSTGNKTGSKAPKENHHHVGKSNSNDAKELHMFVWGSNGSPVS
DRAGLQVDNGANEQVGKSDQGGAKEIRMLISDHTQNGENKAGPMNGDYGGEEESERVKEV
PNGLHKLRCNSTAELNPKEAIETGETVPVKHMPPASVMTRLILIMVWRKLIRNPNTYSSL
IGLIWALVAFRWDVAMPKIIQQSISILSDAGLGMAMFSLGLFMALQPKLIACGNSTATFA
MAVRFFTGPAVMAVAAMAIGLRGDLLRVAIVQAALPQGIVPFVFAKEYNVHPAILSTGVI
FGMLIALPITLVYYILLGL

MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS
TNNPYAMNLRFIAADTLQKIIMLSLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL
LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD
VVSLDGHDFLETDAEIGDDGKLHVTVRKSNASRRSFCGPNMTPRPSNLTGAEIYSLSTTP
RGSNFNHSDFYNMMGFPGGRLSNFGPADMYSVQSSRGPTPRPSNFEENCAMASSPRFGYY
PGGGAGSYPAPNPEFSSTTTSTANKSVNKNPKDVNTNQQTTLPTGGKSNSHDAKELHMFV
WSSNGSPVSDRAGLNVFGGAPDNDQGGRSDQGAKEIRMLVPDQSHNGETKAVAHPASGDF
GGEQQFSFAGKEEEAERPKDAENGLNKLAPNSTAALQSKTGLGGAEASQRKNMPPASVMT
RLILIMVWRKLIRNPNTYSSLIGLIWALVAFRWHVAMPKIIQQSISILSDAGLGMAMFSL
GLFMALQPKLIACGNSVATFAMAVRFLTGPAVMAVAAIAIGLRGDLLRVAIVQAALPQGI
VPFVFAKEYNVHPAILSTGVIFGMLIALPITLVYYILLGL

www.000webhost.com

Other information
Ka divergence:-0.0464891KaKs divergence:0.0123052
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):1860Length 2 (bp):1923Length divergence:0.017
MFE 1 (kcal):-601.35MFE 2 (kcal):-628.6MFE divergence0.022