Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23110-AT1G70900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.7472419806643
Log2 mRNA fold difference:4.3002862403507
Log2 TE fold difference:-1.7169719497392
Sequences
Protein sequence

MSLQNVSKSSNALEGIHGVHVTSHSPFSFEKTTQVSDFQTNTKSSVMESNQRLSIERFWQ
QRPPCLRPICCSIRGDQSVLETAANVATSLPFIFLGMQAPRKNLNTKVYANSLIGVGIAS
SLYHASRGKLRKYLRWVDYTMIATTTICLSRALRNENPKFLMAASALVLPFQPLMVSAVH
TGMMEVAFAKRSLKDPDLKTAHNVHKMSSLLGGALFIADDFFPETPFLHAGWHLAAAIGV
GTCNKLLE

MSPQSVSKTSKSLEGVHGVHVVSHSHFGFESIGQVSGFESADAGTKQRLFIERVWQQRPP
CLRPIHCSIHGDQSILETAANVITSIPFIFLGMQAPRKNLNMKVYANSLIGVGIASSLYH
SSRGKFRKYLRWADYTMIATATICLTRALREENPKFLMAASALALPFQPLVVSAVHTGMM
EVAFAKRALEDPDLKMAHDVHKMSSLLGGALFIADDLFPETPFIHAGWHLAAAIGVGTCN
KLLQ

Other information
Ka divergence:0.00795508KaKs divergence:-0.230933
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):747Length 2 (bp):735Length divergence:-0.008
MFE 1 (kcal):-210.6MFE 2 (kcal):-230.83MFE divergence0.046