Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23150-AT1G70780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:5.9959212446622
Log2 mRNA fold difference:5.2134725546194
Log2 TE fold difference:0.69221945849629
Sequences
Protein sequence

MLLYKKKNQIVKGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILG
SDFNDFVFYCPMVGPGALSPWEAIGSVGVRNFMLCKKKPEEKKVEEDKGRSNFPINGARK
GAGGSFKAWINKSLRLKVTTH

MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPL
LGSDFNDFLLYCPMVGPEALSTWDAIGSLGARNFMLCRKPEEKKVEESNGRSDSTINGAR
KGGSLKAWINKSFNLKVSSH

Other information
Ka divergence:-0.405949KaKs divergence:0.687202
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):426Length 2 (bp):423Length divergence:-0.004
MFE 1 (kcal):-114MFE 2 (kcal):-127.2MFE divergence0.055