Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23170-AT1G70770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function DUF2359, transmembrane
Function (paralog2):Protein of unknown function DUF2359, transmembrane

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.9978118209548
Log2 mRNA fold difference:3.6031642409476
Log2 TE fold difference:-0.65177250115109
Sequences
Protein sequence

MDPIESVEYNGFETTNGNSHNDDHGWKKVVYPKRNRKQKPADQAAATKNGVTGNLIPNGT
LSNGGGNVFRSLEEQAEGRHLQILAAKKASDTADVSDGGRSKWRSNGYGDEGYDFDDSDS
EIAVGKENLKAEEVKKPKVKKVKKPKVTLAEAAAKIDVSNLAAFLVEASESYASQPEIQL
MKFADYFGRSLSQVSSAHFPWVKTFKESPLSKLIDIPLSHIPEAVYKTSADWINQRPIEA
LGAFVLWGLDCILADLAVQQGGVKGGKKGAQQASSKSQVAIFVAVAMVLRKKPDALTNIL
PTLRENPKYQGQDKLPVTVWMMAQASQGDISVGLYSWAHNLLPVVSSKSCNPQSRDLILQ
LVERILSNPKARTILVNGAVRKGERLIPPPSFEILVRLTFPASSARVKATERFEAIYPLL
KEVSLAGAPGSKAMKQVTQQIFTFALKAAGEENPLLAKEAAAITIWALTQNVDCCKHWEN
LYTDNLKASVAVLKKLIGEWKERSVKLTPAETLTLNQTMKSLRQKNEEALTEGGNGVSQS
LYKDADKYCKVIAGKLSSGGCIKSIATTAALLAATGFAGAAALSANPEAIAYLKNLVESL
DINKFTETVMTALKN

MDPIESVEYNGFETSNGNVDHGWKKVVYPKRHRKQKQADQATANGGKTVASNGTVANGGD
NVFRSLEEQAEDRRRRILAAKMTAIDSDDDGVVRSKHRSNGYGDDGYDFDGSDDEIATLK
VEEVKKPKPKKEKKPKVSLPEAASKIDPLNLEAFLVEASESYASQPEIQLMRFADYFGRA
LSGVSSVQFPWVKMFKESPLSKLIEVPLAHIPEPVYKTSVDWINHRPIEALGAFVLWAFD
CILTDLAAQQGGAKGGKKGGQQTTSKSQVAIFVALAMVLRRKPDALTNVLPTLRENPKYQ
GQDKLPVTVWMMAQASQGDIAVGLYSWAHNLLPVVGNKNCNPQSRDLILQLVEKILTNPK
ARTILVNGAVRKGERLIPPPSFEILLRLTFPASSARVKATERFEAIYPLLKEVALAGAPG
SKAMKQVTQQIFTFALKLAGEGNPVLAKEATAIAIWSVTQNFDCCKHWDNLYKENLEASV
AVLKKLVEEWKEHSVKLSSSPNDALTLNRTMKSFRLKNEEVITEGGANASLYKEADKSCK
TISGRLSRGSGCLKGTAITLVFLAAAGAAAAAVLSSNPEVTNELKNLVDSLELHEYINKY
TEVISTALKK

www.000webhost.com

Other information
Ka divergence:-0.0559463KaKs divergence:0.00901425
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1848Length 2 (bp):1833Length divergence:-0.004
MFE 1 (kcal):-615.81MFE 2 (kcal):-606.17MFE divergence-0.008