Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23190-AT1G70730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphoglucomutase/phosphomannomutase family protein
Function (paralog2):Phosphoglucomutase/phosphomannomutase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.3653299661599
Log2 mRNA fold difference:-1.5112152387392
Log2 TE fold difference:0.14389903561433
Sequences
Protein sequence

MVFKVSTVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTAEKVKGATLVVS
GDGRYYSKDAVQIIIKMAAANGVRRVWVGKNTLLSTPAVSAVIRERSGADGSKATGAFIL
TASHNPGGPTEDFGIKYNMENGGPAPESITDKIYENTKTIKEYPIAQDLPNVDISAVGVT
SFEGPEGKFDVEVFDPADDYVKLMKSIFDFEAIRKLLSSPKFTFCYDALHGVAGAYAHRI
FVEELGAQESALLNCTPKEDFGGGHPDPNLTYAKELVARMGLGKSDTGGEPPEFGAAADG
DADRNMILGKRFFVTPSDSVAIIAANAIGAIPYFSSGLKGVARSMPTSAALDVVAKSLNL
KFFEVPTGWKFFGNLMDAGMCSVCGEESFGTGSDHIREKDGIWAVLAWMSILAHKNKGNI
DGNAKLVSVEDIVRQHWATYGRHYYTRYDYENVDAGKAKELMEHLVKLQSSIPEVNKIVK
GIRSDVASVASADEFEYKDPVDGSISKHQGIRYLFEDGSRLVFRLSGTGSEGATIRLYIE
QYEKDASKTGRESQEALSPLVDLALKLSKMEEFTGRSAPTVIT

MFLLVTSCFLPDSGSSVKVSLFIFGTKRDPTKKKNEKRRATRVTFSFSLFISFPQTHCVK
RLLFYHLQAYSIFFRFEMVSFKVSLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQA
TFNALTTEKVKGATLVVSGDGRYYSEQAIQIIVKMAAANGVRRVWVGQNSLLSTPAVSAI
IRERVGADGSKATGAFILTASHNPGGPTEDFGIKYNMENGGPAPESITDKIYENTKTIKE
YPIAEDLPRVDISTIGITSFEGPEGKFDVEVFDSADDYVKLMKSIFDFESIKKLLSYPKF
TFCYDALHGVAGAYAHRIFVEELGAPESSLLNCVPKEDFGGGHPDPNLTYAKELVARMGL
SKTDDAGGEPPEFGAAADGDADRNMILGKRFFVTPSDSVAIIAANAVGAIPYFSSGLKGV
ARSMPTSAALDVVAKNLGLKFFEVPTGWKFFGNLMDAGMCSVCGEESFGTGSDHIREKDG
IWAVLAWLSILAHKNKETLDGNAKLVTVEDIVRQHWATYGRHYYTRYDYENVDATAAKEL
MGLLVKLQSSLPEVNKIIKGIHPEVANVASADEFEYKDPVDGSVSKHQGIRYLFEDGSRL
VFRLSGTGSEGATIRLYIEQYEKDASKIGRDSQDALGPLVDVALKLSKMQEFTGRSSPTV
IT

www.000webhost.com

Other information
Ka divergence:0.047783KaKs divergence:-0.271372
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1752Length 2 (bp):1989Length divergence:0.063
MFE 1 (kcal):-545.4MFE 2 (kcal):-604.84MFE divergence0.052