Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23210-AT1G70710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycosyl hydrolase 9B6
Function (paralog2):glycosyl hydrolase 9B1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.6345999965643
Log2 mRNA fold difference:1.8814254968785
Log2 TE fold difference:-0.26476651366736
Sequences
Protein sequence

MAGKSFMTPAIMLAMLLLISPETYAGHDYRDALRKSILFFEGQRSGKLPPDQRLKWRRDS
ALRDGSSAGVDLTGGYYDAGDNVKFGFPMAFTTTMMSWSVIDFGKTMGPELENAVKAIKW
GTDYLMKATQIPDVVFVQVGDAYSDHNCWERPEDMDTLRTVYKIDKDHSGSEVAGETAAA
LAAASIVFEKRDPVYSKMLLDRATRVFAFAQKYRGAYSDSLYQAVCPFYCDFNGYEDELL
WGAAWLHKASKKRVYREFIVKNQVILRAGDTIHEFGWDNKHAGINVLVSKMVLMGKAEYF
QSFKQNADEFICSLLPGISHPQVQYSQGGLLVKSGGSNMQHVTSLSFLLLTYSNYLSHAN
KVVPCGEFTASPALLRQVAKRQVDYILGDNPMKMSYMVGYGSRFPQKIHHRGSSVPSVVD
HPDRIGCKDGSRYFFSNNPNPNLLIGAVVGGPNITDDFPDSRPYFQLTEPTTYINAPLLG
LLGYFSAHY

MARKSLIFPVILLAVLLFSPPIYSAGHDYRDALRKSILFFEGQRSGKLPPDQRLKWRRDS
ALRDGSSAGVDLSGGYYDAGDNIKFGFPMAFTTTMLSWSIIDFGKTMGPELRNAVKAVKW
GTDYLLKATAIPGVVFVQVGDAYSDHNCWERPEDMDTLRTVYKIDRAHPGSDVAGETAAA
LAAASIVFRKRDPAYSRLLLDRATRVFAFANRYRGAYSNSLYHAVCPFYCDFNGYQDELL
WGAAWLHKASRKRAYREFIVKNEVILKAGDTINEFGWDNKHAGINVLISKEVLMGKAEYF
ESFKQNADGFICSILPGISHPQVQYSRGGLLVKTGGSNMQHVTSLSFLLLAYSNYLSHAK
KVVPCGELTASPSLLRQIAKRQVDYILGDNPMGLSYMVGYGQKFPRRIHHRGSSVPSVSA
HPSHIGCKEGSRYFLSPNPNPNLLVGAVVGGPNVTDAFPDSRPYFQQSEPTTYINAPLVG
LLGYFSAHSTWR

www.000webhost.com

Other information
Ka divergence:-0.482778KaKs divergence:-0.237701
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1470Length 2 (bp):1479Length divergence:0.003
MFE 1 (kcal):-457.26MFE 2 (kcal):-464.14MFE divergence0.007