Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23310-AT1G70580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamate:glyoxylate aminotransferase
Function (paralog2):alanine-2-oxoglutarate aminotransferase 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.9350637903049
Log2 mRNA fold difference:-4.3202444932448
Log2 TE fold difference:0.40279114474397
Sequences
Protein sequence

MALKALDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFI
QRRDGYPSDPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISLLGGTLV
PYYLDESENWGLDVANLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREILKFCY
NEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGIL
ESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSK
M

MSLKALDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVSLCQAPFLLDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISLLGGTLV
PYYLEESENWGLDVNNLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREILRFCC
DERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQR
GGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGIL
ESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYADNFGYSR
M

www.000webhost.com

Other information
Ka divergence:-0.277624KaKs divergence:-0.13933
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1446Length 2 (bp):1446Length divergence:0
MFE 1 (kcal):-445.6MFE 2 (kcal):-426.84MFE divergence-0.022