Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23340-AT1G70550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of Unknown Function (DUF239)
Function (paralog2):Protein of Unknown Function (DUF239)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.7998428014172
Log2 mRNA fold difference:2.1096132681825
Log2 TE fold difference:-0.3575412481879
Sequences
Protein sequence

MSSSSSCLFFTFILLLSLFSSYASPSNSTSETVPLRPQREIQKMKLIRKQLQKINKPAIK
TIHSSDGDTIDCVPSHHQPAFDHPLLQGQRPMDPPEMPIGYSQENESHENFQLWSLYGES
CPEGTIPIRRTTEQDMLRANSVRRFGRKIRRVRRDSSSNGHEHAVGYVSGSQYYGAKASI
NVWTPRVISQYEFSLSQIWIIAGSFAGDLNTIEAGWQISPELYGDTNPRFFTYWTSDAYQ
ATGCYNLLCSGFVQTNNRIAIGAAISPVSSYKGGQFDISLLIWKDPKHGHWWLQFGSGTL
VGYWPVSLFTHLREHGNMVQFGGEIVNTRPGGSHTSTQMGSGHFAGEGFGKASYFRNLQM
VDWDNTLIPISNLKVLADHPNCYDIRGGVNRVWGNFFYYGGPGKNSKCP

MCLIGLLGDVSVTSRRRTTIQNRIKCCLFDHSRRKQQDSRCFHHSSQQVSFKSDPMFSSS
FLRLILLLCLVSSSFSSTTSSSNSTAADQTLRPQEELQKLTLIRQELDKINKPAVKTIQS
SDGDKIDCVSTHQQPAFDHPLLQGQKPLDPPEIPKGYSEDDGSYENSQLWSLSGESCPEG
TIPIRRTTEQDMLRASSVQRFGRKIRRVKRDSTNNGHEHAVGYVTGRQYYGAKASINVWS
PRVTSQYEFSLSQIWVIAGSFTHDLNTIEAGWQISPELYGDTYPRFFTYWTSDAYRTTGC
YNLLCSGFVQTNRRIAIGAAISPRSSYKGGQFDISLLIWKDPKHGHWWLQFGSGALVGYW
PAFLFTHLKQHGSMVQFGGEIVNNRPGGSHTTTQMGSGHFAGEGFGKASYFRNLQIVDWD
NTLIPASNLKILADHPNCYDIRGGTNRVWGNYFYYGGPGKNPRCP

www.000webhost.com

Other information
Ka divergence:-0.0252058KaKs divergence:-0.0862505
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1230Length 2 (bp):1398Length divergence:0.064
MFE 1 (kcal):-355.88MFE 2 (kcal):-398.24MFE divergence0.056