Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23380-AT1G70510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):KNOTTED1-like homeobox gene 6
Function (paralog2):KNOTTED-like from Arabidopsis thaliana 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.63877235995
Log2 mRNA fold difference:-0.050650722904277
Log2 TE fold difference:-1.2915243991332
Sequences
Protein sequence

MDGMYNFHSAGDYSDKSVLMMSPESLMFPSDYQALLCSSAGENRVSDVFGSDELLSVAVS
ALSSEAASIAPEIRRNDDNVSLTVIKAKIACHPSYPRLLQAYIDCQKKQVGAPPEIACLL
EEIQRESDVYKQEVVPSSCFGADPELDEFMETYCDILVKYKSDLARPFDEATCFLNKIEM
QLRNLCTGVESARGVSEDGVISSDEELSGGDHEVAEDGRQRCEDRDLKDRLLRKFGSRIS
TLKLEFSKKKKKGKLPREARQALLDWWNLHYKWPYPTEGDKIALADATGLDQKQINNWFI
NQRKRHWKPSENMPFAMMDDSSGSFFTEE

MDRMCGFRSTEDYSEKATLMMPSDYQSLICSTTGDNQRLFGSDELATALSSELLPRIRKA
EDNFSLSVIKSKIASHPLYPRLLQTYIDCQKVGAPMEIACILEEIQRENHVYKRDVAPLS
CFGADPELDEFMETYCDILVKYKTDLARPFDEATTFINKIEMQLQNLCTGPASATALSDD
GAVSSDEELREDDDIAADDSQQRSNDRDLKDQLLRKFGSHISSLKLEFSKKKKKGKLPRE
ARQALLDWWNVHNKWPYPTEGDKISLAEETGLDQKQINNWFINQRKRHWKPSENMPFDMM
DDSNETFFTE

www.000webhost.com

Other information
Ka divergence:0.209008KaKs divergence:0.847926
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):990Length 2 (bp):933Length divergence:-0.03
MFE 1 (kcal):-305.08MFE 2 (kcal):-290.05MFE divergence-0.025