Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23460-AT1G70500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pectin lyase-like superfamily protein
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.8576763808596
Log2 mRNA fold difference:-0.41395908215625
Log2 TE fold difference:-0.9548198056191
Sequences
Protein sequence

MMDKLFILSLLGLLLVTAYGAAGKMVYTDLDILDELENFDVLVDDDDDTKLLDWPSFTSR
HSGKNLVNVDTFGAAGDGVSDDTQAFVSAWSKACSTSKSVFLVPEGRRYLVNATKFNGPC
EQKLIIQIDGTIVAPDEPSNWDSKFQRIWLEFSKLKGVVFQGKGVIDGSGSKWWAASCKK
NKSNPCKSAPTALTIESSSGVKVSGLTIQNSQQMNFIIARSDSVRVSKVMVSSPGDSPNT
DGIHITGSTNVILQDCKIGTGDDCVSIVNASSNIKMKNIYCGPGHGISIGSLGKDNTTGI
VTQVVLDTALLRETTNGLRIKTYQGGSGYVQGIRFTNVEMQDVANPILIDQFYCDSPTTC
QNQTSAVKISQIMYRNITGTTKSAKAIKFACSDTVPCSHIVLNNVNLEGNDGQVEAYCNS
AEGFGYGVIHPSADCLYSHDDKGLDQTHKSEEAETGHDEL

MIKPFIISLFALLMVASYGATGKMLFKELDILGKLENLDVPEDDIEDDVTFFDFSSFTSQ
YSGKNLVNVDSFNASGDGVSDDTQAFIRAWTMACSAPNSVLLVPQGRSYLVNATKFDGPC
QEKLIIQIDGTIIAPDEPSQWDPKFPRNWLQFSKLQGVVFQGNGVIDGSGTKWWAASCKK
NKSNPCVGAPTALTIYSSSNVYVRGLTIRNSQQMHLIIQRSTTVRISRVMVTSPGDSPNT
DGIHITASTDVVVQDSKISTGDDCVSIVNGSAKIKMKRIYCGPGHGISIGSLGQGHSKGT
VTAVVLETAFLKNTTNGLRIKTWQGGNGYVKGVRFENVVMQDVANPIIIDQFYCDSPSTC
QNQTSAVHISEIMYRNITGTTKSSKAINFKCSDAVPCSHIVLNNINLEGNDGKVEAYCNS
AEGFGYGVVHPSADCLYSHDDKSLNQTDQYLAETIMVEKETENAHDEL

Other information
Ka divergence:0.218543KaKs divergence:0.405617
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1383Length 2 (bp):1407Length divergence:0.009
MFE 1 (kcal):-418.41MFE 2 (kcal):-407.8MFE divergence-0.013