Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23530-AT1G70470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.35519168627947
Log2 mRNA fold difference:0.20498583888992
Log2 TE fold difference:0.205582082978
Sequences
Protein sequence

MGDQGVQQMQQPIVVYPNAYNKQYPDPSTKPSSSSGSSGNFGTVFIVLAVIFVLSALACV
FGRLCNRESRAAKQQHSKHPKHEKASSKKSREIRPVEREPRERGDMDFGFDMKRPEPIEK
PSGRDGGEDIEFGFDNKRGERGREGGGGGGPPPPNIKHAVRFKLPENGDHHSKGEIRRGG
PSFEFRPGH

MGDQPQEFQQPQVYPSTSSSTSSSFSPSSSGSSGSFGTAFIVLAAILVLAALACVFGRLC
NRGGKQHKDKNNNKASKHEKPSSKKSREIRPVEREPRERGDVEFGFDMKRPGPMSKPTGR
NGGDIEFGFDNKRGGGGGGGGGGKGGKRPPPVIY

www.000webhost.com

Other information
Ka divergence:0.0671287KaKs divergence:0.0859044
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):570Length 2 (bp):465Length divergence:-0.101
MFE 1 (kcal):-188.9MFE 2 (kcal):-141.4MFE divergence-0.144