Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23540-AT1G70460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):root hair specific 10

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.0887233868722
Log2 mRNA fold difference:2.2645848810111
Log2 TE fold difference:-0.37007051643197
Sequences
Protein sequence

MSDLGESPSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP
DSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESN
DNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPI
QPSGPATSPPANPNAPPSPFPTVPPKTPSSGPVVSPSLTSPSKGTPTPNQGNGDGGGGGG
GYQGKTMVGMAVAGFAIMALIGVVFLVRRKKKRNIDSYNHSQYLPHPNFSVKSDGFLYGQ
DPGKGYSSGPNGSMYNNSQQQQSSMGNSYGTAGGGYPHHQMQSSGTPDSAILGSGQTHFS
YEELAEITQGFARKNILGEGGFGCVYKGTLQDGKVVAVKQLKAGSGQGDREFKAEVEIIS
RVHHRHLVSLVGYCISDQHRLLIYEYVSNQTLEHHLHGKGLPVLEWSKRVRIAIGSAKGL
AYLHEDCHPKIIHRDIKSANILLDDEYEAQVADFGLARLNDTTQTHVSTRVMGTFGYLAP
EYASSGKLTDRSDVFSFGVVLLELVTGRKPVDQTQPLGEESLVEWARPLLLKAIETGDLS
ELIDTRLEKRYVEHEVFRMIETAAACVRHSGPKRPRMVQVVRALDCDGDSGDISNGIKIG
QSTTYDSGQYNEDIMKFRKMAFGGDNSVESGLYSGNYSAKSSSDFSGNESETRPFNNRRF

MSDSPTSSPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFS
PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPP
PEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATS
PPAPPNAPPRNSSHALPPKSTAAGGPLTSPSRGVPSSGNSVPPPANSGGGYQGKTMAGFA
IAGFAVIALMAVVFLVRRKKKRNIDAYSDSQYLPPSNFSIKSDGFLYGQNPTKGYSGPGG
YNSQQQSNSGNSFGSQRGGGGYTRSGSAPDSAVMGSGQTHFTYEELTDITEGFSKHNILG
EGGFGCVYKGKLNDGKLVAVKQLKVGSGQGDREFKAEVEIISRVHHRHLVSLVGYCIADS
ERLLIYEYVPNQTLEHHLHGKGRPVLEWARRVRIAIGSAKGLAYLHEDCHPKIIHRDIKS
ANILLDDEFEAQVADFGLAKLNDSTQTHVSTRVMGTFGYLAPEYAQSGKLTDRSDVFSFG
VVLLELITGRKPVDQYQPLGEESLVEWARPLLHKAIETGDFSELVDRRLEKHYVENEVFR
MIETAAACVRHSGPKRPRMVQVVRALDSEGDMGDISNGNKVGQSSAYDSGQYNNDTMKFR
KMAFGFDDSSDSGMYSGDYSVQDSRKGSNGASSEFTRNETENRNFNNRRY

www.000webhost.com

Other information
Ka divergence:0.114409KaKs divergence:0.149425
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):2163Length 2 (bp):2133Length divergence:-0.007
MFE 1 (kcal):-623.49MFE 2 (kcal):-679.78MFE divergence0.043