Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23550-AT1G70440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):similar to RCD one 2
Function (paralog2):similar to RCD one 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.8359652677111
Log2 mRNA fold difference:-2.0769531320102
Log2 TE fold difference:0.035452840707816
Sequences
Protein sequence

MAAQVEIEDQTSVTNLDNGEIFDSISDDADSSVSHAGSSFSSSSLILLGEGNPEHDVIKT
CLLSGMGVVSSDTTIVTISKNSSERGITTRAKFLAFRIFTDAVARKHGGDANVKYGWYAG
SRDEIQRIISYGFSNRDVGKFENDGGSHGIGIHLVPSKCSLLAASATEQDEEGLRYLLLC
RVILGKPEIIISGSKQSYPSSAEFDSGVDDLHNPRNYVIWSCNMNSCILPSYIVSFRSPR
LRVSRGGFASRPSSPWVSFASLMSMLSTSMDPSRMNLIIRTYDDFRKRKIRRDQLVRKMR
EVAGDNLLAEIIKNHKNRNKVTN

MAAQVEIEDQESVTNLDNGEIINPISDNAPNFSGDATILLREATFEHNLIKNCFLSGMGS
FATETTIVTVRKILTQRLITTKAKFAVFKLFTEAMKRKNNGYANIRYGWYSGSKEEIDRV
ITYGFSNREIKKVENDVGSHGVGIHLVHHRYSLAAALVGEGDEEGIKNILLCRVILGKPE
QIVTGSKQSYPSSNQFDSGVDNLENPRKYVIWSCNMNSYILPTYIVSFKSHLLRGLIGRA
RSPCVSFSVLMSILSKSLDAARMNLILTSYDDFRKRKLRREQLVRKIREVVGDNLLFKIL
KNQRR

Other information
Ka divergence:0.284122KaKs divergence:-0.344262
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):972Length 2 (bp):918Length divergence:-0.029
MFE 1 (kcal):-311.34MFE 2 (kcal):-247.22MFE divergence-0.115