Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23710-AT1G70420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1645)
Function (paralog2):Protein of unknown function (DUF1645)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.2907783110718
Log2 mRNA fold difference:0.17185333463359
Log2 TE fold difference:-1.5030470795626
Sequences
Protein sequence

MEVAFPSSPPVKCIADERLTEISMDFTKLGFPEEDEEIKKLERSWSKLEESVEFNEDDEE
EEEEFSFACVNGEGSPITADEAFEDGQIRPVFPLFNRDLLFEYENEDDKNDNVSVTDENR
PRLRKLFVEDRNGNGDGEETEGSEKEPLGPYCSWTGGTVAEASPETCRKSNSTGFSKLWR
FRDLVLRSNSDGRDAFVFLNNSNDKTRTRSSSSSSSTAAEENDKKVITEKKKGKEKTSTS
SETKKKTTTTKSAHEKLYMRNRAMKEEVKHRSYLPYKQVGFFTNVNGLSRNIHPF

MQVISPSSPAPRFAGKERFSEVYGELNDDFGSKLKISSKEEENRDDDSWWNQNGTDKDDE
GREEDFSFASVNADNSPITADEAFEDGQIRPVYPLFNRNIFFDDPEEKTLRSPLKKLFVE
STTTEEEEEESDTVGPYCSWTNRTVEQASPETCRKSNSTGFSKLWRFRDLVLRSNSDGKD
AFVFLSNGSSSTSSTSSTAARLSGVVKSSEKGKEKTKTDKKKDKMRTKSAHEKLYMRNRA
MREEGKRRSYLPYKHVGFFTNVNGLTRNVHPY

www.000webhost.com

Other information
Ka divergence:0.174158KaKs divergence:-0.0531352
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):888Length 2 (bp):819Length divergence:-0.04
MFE 1 (kcal):-286.8MFE 2 (kcal):-228.8MFE divergence-0.112