Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23730-AT1G70410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):beta carbonic anhydrase 3
Function (paralog2):beta carbonic anhydrase 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:5.8553556217828
Log2 mRNA fold difference:5.5125585827413
Log2 TE fold difference:0.28587905769241
Sequences
Protein sequence

MSTESYEDAIKRLGELLSKKSDLGNVAAAKIKKLTDELEELDSNKLDAVERIKSGFLHFK
TNNYEKNPTLYNSLAKSQTPKFLVFACADSRVSPSHILNFQLGEAFIVRNIANMVPPYDK
TKHSNVGAALEYPITVLNVENILVIGHSCCGGIKGLMAIEDNTAPTKTEFIENWIQICAP
AKNRIKQDCKDLSFEDQCTNCEKEAVNVSLGNLLSYPFVRERVVKNKLAIRGAHYDFVKG
TFDLWELDFKTTPAFALS

MAPAFGKCFMFCCAKTSPEKDEMATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAEL
KELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTPKFLVFACSDSRVCPSHIL
NFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMS
IEDDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPF
VRAEVVKNTLAIRGGHYNFVKGTFDLWELDFKTTPAFAFS

Other information
Ka divergence:-0.10443KaKs divergence:-0.0183942
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):777Length 2 (bp):843Length divergence:0.041
MFE 1 (kcal):-207.6MFE 2 (kcal):-248.6MFE divergence0.09