Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23760-AT1G70370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BURP domain-containing protein
Function (paralog2):polygalacturonase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.1019089383957
Log2 mRNA fold difference:4.7308726123721
Log2 TE fold difference:-0.69778148300309
Sequences
Protein sequence

MRKQFVFLLPFLSRLYHVVIAGGERLTNGGFSPEINPFTPKASLVRYWNKQIHHQSPGSA
FLLSKASPLTAVASATFAKLASENALPDRLPDFCSAANLFCFPDLGPTLEKHSNDVKFSV
YDQRNFTNYGTIHPGGADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEE
KFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAYSDEGNGRAQTFKTYTHEANSGPGQSFT
SYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGA
SGNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEG
NKIDFKTYTQNSTFKDYTKTGVEFAKYNRSSLGGGKTVNKWVEPGKFFRESMLKEGTLIW
MPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHANDNSTMEGIITDAVRECERPPT
VSETKRCVGSAEDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNGINGGRVTKSVSC
HQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAWGANHGAFMLLGS
RPGQIEVCHWIFENDMNWAIAD

MLKQFLLLQSFSFFLFNVVIVGGRTFGGGFSAEENPFTPKASLVRYWNKEIRGQSPRSEF
LISKASPLNAVDSATFSKLAAANSLPTRFPDFCSAANLFCFPDLGASLEKHDDDVKFSVY
DQKNFTNYGNARAGGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEG
FNSYGTFGTGGAGDFTNYQNNVNNPTSRFTAYSDGGNGRSQTFKTYTHEANAGNGQSFTS
YGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGAS
GNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGS
KLSFKTYTPNSTFKDYAKKGVAFAKYNVSTTTANTVGDGKTVNKWIEPGKFFRESSLKEG
TVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAVTECE
RPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKEKVVIGKVNGINGGKLTK
AVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFL
ALGSKPGRIEVCHWIFENDMNWAIAD

Other information
Ka divergence:-0.251806KaKs divergence:0.220183
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1869Length 2 (bp):1881Length divergence:0.003
MFE 1 (kcal):-569.41MFE 2 (kcal):-580.06MFE divergence0.009