Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23790-AT1G70340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF936)
Function (paralog2):Plant protein of unknown function (DUF936)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.4228504544892
Log2 mRNA fold difference:-0.35726876863189
Log2 TE fold difference:-2.117803273864
Sequences
Protein sequence

MAALAPGILQKLIDGMKTGVKPTGEHRSSLLQVTDIVPIDLDEKNLLPKQGFFIKVSDSS
HSIYVSLPSDQDDDVLSNKMQLGQFIYVDRLDPGTPVPIIKGARPIPGRHPLLGTPEPLM
STRGKIESSRPRRGSWGQNGDVSSPFVLKPAPLDFDQCTPAKHRLGTGRFMAASPNVMTR
GRSPGGVRCSYGGGLLSKMAESPAAMMRKSCVVPPSSKFPRSKSVCDRETMAKNSVLFSP
FKSSAKKNDSPPPSVRTRRATAASLLEDEREAPKSTSKYSKLEKPEKSLSLPGRLSTLSK
EAMQQRETAQKIALQALREATTTETVVRHLKTFANLSKSAKADCPAACFDKFLEFHSQIS
ETMNEIASIEAAASPATTEKKSEDGSLILHEIQHNSIDQEKTTSKRRILLKQQQKRSNDE
NKNPAVSLSGLGNTARLVKEIEKEAANWFMEFIEKALEKGMKKCKGTSDADVKKVPQSLI
LKVVNWVEEEHSADNTKRPVHPKASHITRKLRIKLKNP

MAALAPGILQKLIQGMKTGIKPTREHRSSMLQVTDIVPIDLDEKSLEPKQGFLIKISDSS
HSIYVSLPSDQDDVVLSNKLQLGQFIYVDRLEPGSPVPVIKGAKPIPGRHPLLGTPETLV
VPKERTDQEIGSKPRRGSWGQNVDFSSSPFVVKPMALEFDHSTPAKRSVSARFAASPIRR
GGVRCSFGGGVLGKLEGESPATAMLRKSCFVSSASKFPRSRSVCDRQAKKNNASLFSPFK
SSLEAQEDVVPLSTSKKIKPEKDTNLSGRLNILSKEATQLREVAQKVALQALREATITEI
VVRHTKTFTNLSKSAKADCPAVCFEKFMEFHQQMAQTIGELTSIEVAATPDAENKSQNIN
ARTENQKPTEEGSSSILHEIAYNSIDQEKRRSKRRIVLKQQSEGKTVRSNDENKNPASGG
ISNTIRLAKEIEDEAANWFMEFIEIALEKGMKKSRGPDDADVKKVPQSLILGVLNWIEVE
QSDSNNNKRRRVHPKASKITRKLRIKLKNP

www.000webhost.com

Other information
Ka divergence:0.298292KaKs divergence:0.0544721
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1557Length 2 (bp):1533Length divergence:-0.008
MFE 1 (kcal):-451.09MFE 2 (kcal):-475.58MFE divergence0.026