Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23820-AT1G70310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):spermidine synthase 1
Function (paralog2):spermidine synthase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.27862109502208
Log2 mRNA fold difference:0.38065526002284
Log2 TE fold difference:0.016649404924233
Sequences
Protein sequence

MIFSVVRSSLPYIFRFTSHQNHHLSQTLVPPLSHFSEIFTRAITMDAKETSATDLKRPRE
EDDNGGAATMETENGDQKKEPACFSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQ
DVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLR
EVARHASIEQIDMCEIDKMVVDVSKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAEGSYD
AVIVDSSDPIGPAKELFEKPFFQSVARALRPGGVVCTQAESLWLHMDIIEDIVSNCREIF
KGSVNYAWTSVPTYPSGVIGFMLCSTEGPDVDFKHPLNPIDESSSKSNGPLKFYNAEIHS
AAFCLPSFAKKVIESKAN

MSSTQEASVTDLPVKRPREAEEDNNGGAMETENGGGEIKEPSCMSSIIPGWFSEISPMWP
GEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLC
SISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQYFPNVAVGYEDPRV
NLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRALRPGGVVCTQAE
SLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSGVIGFMLCSSEGPQVDFKKPVSLI
DTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVIDSKAN

Other information
Ka divergence:0.230826KaKs divergence:0.0505232
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1137Length 2 (bp):1023Length divergence:-0.053
MFE 1 (kcal):-347.92MFE 2 (kcal):-319.64MFE divergence-0.042