Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23830-AT1G23840
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.805099886759
Log2 mRNA fold difference:-1.906194676583
Log2 TE fold difference:0.22264907682351
Sequences
Protein sequence

METNSEEKLSVIELLKRALKLLFGNINLLLFLCLCSLPLFFFLIFFELSLQTTVYLTSQF
LWKLLILGEDLPENDLILISEKKNDLISWLIQTFLLYFFPYTILDLLTTTTIVAASSIVY
TSKEEPLGLLYLVERSIKICQNRVGGCLITSLYVLLWSTSVFLFFFLFFFLQFLSGSTNY
VSIPYLSREYKGFHYQPTGLFNVVVPLTLLMQCTLFIVLTAKYSKWSSGWNMGLVVSVLE
EDEDGQGIYGGDALSLSGWYRKGHEKRDLWLMLMFLVFGLATRMPCLYSKCSASGNGVMY
TGFYVGLICVGNLLKWVTCLACYHDCKTMVLRKKRDVEQAKTPAA

METKSEEKLSVIELLKRALKLLFGNINLALFLFLCSLPLFCFLIFFELSLQTTVSLASTY
ISKLVNSEEDLSENDLLPWLIQTTLLYFFPYTILDLLTTTTIVAASSIAYTSEEEPLGLL
YLVGRSFKLCQNKVGGCLITSLYVLLLSTSVFLGLFSGSTIYLYFASLTLEQQIFFNQAV
VQDQRFLEQAVVLLDVVVVLIHGTVFIVLAAKFSKWSAGWNISMVVSVLEEEEDSKGIYG
SSALSLSAWYLRGQEKRDFWMMLVFLVGALVTRMPCLYYKCSESLSGNGVLYTGLYVSLI
CVGNVVKWVSCVVWYHDCNTRVLRKKGDVEIGSKAFAT

www.000webhost.com

Other information
Ka divergence:-0.275761KaKs divergence:0.929011
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1038Length 2 (bp):1017Length divergence:-0.01
MFE 1 (kcal):-282.38MFE 2 (kcal):-292MFE divergence0.017