Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23870-AT1G70290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):trehalose-phosphatase/synthase 9
Function (paralog2):trehalose-6-phosphatase synthase S8

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4999579474227
Log2 mRNA fold difference:2.0223438234888
Log2 TE fold difference:-0.51990402575221
Sequences
Protein sequence

MVSRSCANFLDLASWDLLDFPQTQRALPRVMTVPGIISELDGGYSDGSSDVNSSNSSRER
KIIVANMLPLQAKRDTETGQWCFSWDEDSLLLQLRDGFSSDTEFVYIGSLNADIGISEQE
EVSHKLLLDFNCVPTFLPKEMQEKFYLGFCKHHLWPLFHYMLPMFPDHGDRFDRRLWQAY
VSANKIFSDRVMEVINPEEDYVWIHDYHLMVLPTFLRKRFNRIKLGFFLHSPFPSSEIYR
TLPVRDDLLRGLLNCDLIGFHTFDYARHFLSCCSRMLGLDYESKRGHIGLDYFGRTVFIK
ILPVGIHMGRLESVLNLPSTAAKMKEIQEQFKGKKLILGVDDMDIFKGISLKLIAMERLF
ETYWHMRGKLVLIQIVNPARATGKDVEEAKKETYSTAKRINERYGSAGYQPVILIDRLVP
RYEKTAYYAMADCCLVNAVRDGMNLVPYKYIICRQGTPGMDKAMGISHDSARTSMLVVSE
FIGCSPSLSGAIRVNPWDVDAVAEAVNLALTMGETEKRLRHEKHYHYVSTHDVGYWAKSF
MQDLERACREHYNKRCWGIGFGLSFRVLSLSPSFRKLSIDHIVSTYRNTQRRAIFLDYDG
TLVPESSIIKTPNAEVLSVLKSLCGDPKNTVFVVSGRGWESLSDWLSPCENLGIAAEHGY
FIRWSSKKEWETCYSSAEAEWKTMVEPVMRSYMDATDGSTIEYKESALVWHHQDADPDFG
ACQAKELLDHLESVLANEPVVVKRGQHIVEVKPQGVSKGLAVEKVIHQMVEDGNPPDMVM
CIGDDRSDEDMFESILSTVTNPDLPMPPEIFACTVGRKPSKAKYFLDDVSDVLKLLGGLA
AATSSSKPEYQQQSSSLHTQVAFESII

MVSRSCANFLDLSSWDLLDFPQTPRTLPRVMTVPGIITDVDGDTTSEVTSTSGGSRERKI
IVANMLPLQSKRDAETGKWCFNWDEDSLQLQLRDGFSSETEFLYVGSLNVDIETNEQEEV
SQKLLEEFNCVATFLSQELQEMFYLGFCKHQLWPLFHYMLPMFPDHGDRFDRRLWQAYVS
ANKIFSDRVMEVINPEDDYVWIQDYHLMVLPTFLRKRFNRIKLGFFLHSPFPSSEIYRTL
PVRDEILRGLLNCDLIGFHTFDYARHFLSCCSRMLGLDYESKRGHIGLDYFGRTVYIKIL
PVGVHMGRLESVLSLDSTAAKTKEIQEQFKGKKLVLGIDDMDIFKGISLKLIAMEHLFET
YWHLKGKVVLVQIVNPARSSGKDVEEAKRETYETARRINERYGTSDYKPIVLIDRLVPRS
EKTAYYAAADCCLVNAVRDGMNLVPYKYIVCRQGTRSNKAVVDSSPRTSTLVVSEFIGCS
PSLSGAIRVNPWDVDAVAEAVNSALKMSETEKQLRHEKHYHYISTHDVGYWAKSFMQDLE
RACRDHYSKRCWGIGFGLGFRVLSLSPSFRKLSVEHIVPVYRKTQRRAIFLDYDGTLVPE
SSIVQDPSNEVVSVLKALCEDPNNTVFIVSGRGRESLSNWLSPCENLGIAAEHGYFIRWK
SKDEWETCYSPTDTEWRSMVEPVMRSYMEATDGTSIEFKESALVWHHQDADPDFGSCQAK
EMLDHLESVLANEPVVVKRGQHIVEVKPQGVSKGLAAEKVIREMVERGEPPEMVMCIGDD
RSDEDMFESILSTVTNPELLVQPEVFACTVGRKPSKAKYFLDDEADVLKLLRGLGDSSSS
LKPSSSHTQVAFESIV

Other information
Ka divergence:0.149235KaKs divergence:-0.111502
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):2604Length 2 (bp):2571Length divergence:-0.006
MFE 1 (kcal):-812.96MFE 2 (kcal):-778.84MFE divergence-0.021