Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23880-AT1G70280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NHL domain-containing protein
Function (paralog2):NHL domain-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.6585187014631
Log2 mRNA fold difference:3.284133124769
Log2 TE fold difference:-0.62252715492608
Sequences
Protein sequence

MTNVSLFYASLSILFCCFLFFFNLSPSFFFLRLSRSVTTSFNILNIHLSHFAIRLSSTLV
MSRHFLFLGIIILLFSAFVASAPSSTSPAKIVNSFISNHGTSLLKWLWSLSFKTTTKTAV
PTKSMVKFENGYSVETVLDGSKLGIEPYSIQVLSNGELLILDSQNSNIYQISSSLSLYSR
PRLVTGSPEGYPGHVDGRLRDARLNNPKGLTVDDRGNIYVADTVNNAIRKISEAGVTTIA
GGKMVRGGGHVDGPSEDAKFSNDFDVVYLGSSCSLLVIDRGNQAIREIQLHFDDCADQYG
SGFPLGIAVLVAAVFFGYMLALLQRRLSSIVSYHTDQEVFEAVPDQDPIKPVRPPLILTG
DEQEKQEESFLGTLQIFISNAWVFSVELFSGMFPGLRKKQTVGLNFNHQETKHSAFSTTS
WPIQESFVIHNKDEPPPVESRNATPGKIYPFMSKDATEKMQQLRQSRALYRSLDAEFLQE
QQQEKHQQYHHRHHSTIPYTLYEQSSEKTNEIVFGPGQEQDQMNTHQNIHHRAHQFVSYP
YGYYS

MGRDFLVLSILILLLSGIVSSAPSANSPAKILNGFISNHGSSLMKWLWSLKTTTKTTIAT
RSMVKFENGYSVETVFDGSKLGIEPYSIEVLPNGELLILDSENSNIYKISSSLSLYSRPR
LVTGSPEGYPGHVDGRLRDAKLNHPKGLTVDDRGNIYVADTVNNAIRKISEGGVTTIAGG
KTVRNGGHVDGPSEDAKFSNDFDVVYVGSSCSLLVIDRGNKAIREIQLHFDDCAYQYGSG
FPLGIAVLVAAGFFGYMLALLQRRVGSIVSSHNDQEMFEADPDQKPMKHSRPSLIPAGDE
QLEKQEETFVVSLGKLVSNAWESVMEILRKKQTGTSFQQYHGTTKQSAAFSTSTPWPIQE
SFVIRDEDGPPPVEPRNPTPRKTYAFMSKDAEKMQQLRQSRAFYSSWDAEFPNQQQQQQK
QHQKHQHQQQQQQQHRRHYSSIPHTYYEQDSEKSNEIVFGAVQEQSSKRVAKPKPKPIES
GDQMNNNTQQNLHYRSHSVSYPYGYYPNT

www.000webhost.com

Other information
Ka divergence:-0.344388KaKs divergence:-0.684421
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1638Length 2 (bp):1530Length divergence:-0.034
MFE 1 (kcal):-439.21MFE 2 (kcal):-442.53MFE divergence0.004