Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G23900-AT1G23940
Species:Arabidopsis
Duplication type:TD
Function (paralog1):gamma-adaptin 1
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.8811615680219
Log2 mRNA fold difference:-2.1055974838195
Log2 TE fold difference:-0.67182958657505
Sequences
Protein sequence

MNPFSSGTRLRDMIRAIRACKTAAEERAVVRKECADIRALINEDDPHDRHRNLAKLMFIH
MLGYPTHFGQMECLKLIASPGFPEKRIGYLGLMLLLDERQEVLMLVTNSLKQDLNHSNQY
VVGLALCALGNICSAEMARDLAPEVERLIQFRDPNIRKKAALCSTRIIRKVPDLAENFVN
AAASLLKEKHHGVLITGVQLCYELCTINDEALEYFRTKCTEGLIKTLRDITNSAYQPEYD
VAGITDPFLHIRLLRLLRVLGQGDADASDLMTDILAQVATKTESNKNAGNAVLYECVETI
MAIEDTNSLRVLAINILGRFLSNRDNNIRYVALNMLMKAITFDDQAVQRHRVTILECVKD
PDASIRKRALELVTLLVNENNVTQLTKELIDYLEISDEDFKEDLSAKICFIVEKFSPEKL
WYIDQMLKVLCEAGKFVKDDVWHALIVVISNASELHGYTVRALYKSVLTYSEQETLVRVA
VWCIGEYGDLLVNNVGMLGIEDPITVTESDAVDVIEDAITRHNSDSTTKAMALVALLKLS
SRFPSISERIKDIIVKQKGSLLLEMQQRAIEYNSIVDRHKNIRSSLVDRMPVLDEATFNV
RRAGSFPASVSTMAKPSVSLQNGVEKLPVAPLVDLLDLDSDDIMAAPSPSGTDFLQDLLG
VDLGSSSAQYGATQAPKAGTDLLLDILSIGTPSPAQNSTSSIGLLSIADVNNNPSIALDT
LSSPAPPHVATTSSTGMFDLLDGLSPSPSKEATNGPAYAPIVAYESSSLKIEFTFSKTPG
NLQTTNVQATFTNLSPNTFTDFIFQAAVPKFLQLHLDPASSNTLLASGSGAITQNLRVTN
SQQGKKSLVMRMRIGYKLNGKDVLEEGQVSNFPRGL

MELVALVKLLSGFPSISKRIKDIIVKQKGSLLLGMQQRAIEYNSIVDRHKNIRSSLVDRM
PVLDEATFNVRRAGHFPASASTMAQFSVSLPNGVEKPAVDLLFDEDFFQDLLCVYLGSSL
SQSGATQAPKAGTYRDMIRAVRACQTAAEERAVVRKECANIRALINEDDPHDRHRNLAKL
MLIHMLGYPTHFVQMECLKLIASPGFPEKRIGYLGLMLMLVTKSLKQDLNHSNQYVVGLA
LFALGNICSAEMAPDLAPEVERLVQFRDPNIRKKAALCSTRIVRKVPDLVENFVNADASL
LKEKHHGVLIRGVQLCYELCTINDEALEYFRTKCTEGLIKFLRDITNCAYQPEYDVAGIT
DPFLQRRLLRFLRVLGQGDADASDLMTHILAQVTESDAVDAIEDAIAGHNSDLTTKVMAF
VALLKLSSGFPSISERIKDMIVKQKGSLHLEMQQRAIEFNSIVERHKRIRSSMGERMAEL
DEAVFNVRRAGSLLA

Other information
Ka divergence:0.838124KaKs divergence:0.592425
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2631Length 2 (bp):1488Length divergence:-0.277
MFE 1 (kcal):-774.5MFE 2 (kcal):-457.05MFE divergence-0.258