Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24140-AT1G70170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Matrixin family protein
Function (paralog2):matrix metalloproteinase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.115974516387
Log2 mRNA fold difference:1.4258555790499
Log2 TE fold difference:-0.27497174506153
Sequences
Protein sequence

MVRICVFMVFLLFFAPSPVSAGFYTNSSAIPPQLLRNATGNPWNSFLNFTGCHAGKKYDG
LYMLKQYFQHFGYITETNLSGNFTDDFDDILKNAVEMYQRNFQLNVTGVLDELTLKHVVI
PRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEPRWPRNRRDLTYAFD
PRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSGEHGDGEPFDGPMRT
LAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHEIGHLLGLGHSSVEG
SIMYPTIRTGRRKVDLTTDDVEGVQYLYGANPNFNGSRSPPPSTQQRDTGDSGAPGRSDG
SRSVLTNLLQYYFWIIFGLFLYLV

MRFCVFGFLSLFLIVSPASAWFFPNSTAVPPSLRNTTRVFWDAFSNFTGCHHGQNVDGLY
RIKKYFQRFGYIPETFSGNFTDDFDDILKAAVELYQTNFNLNVTGELDALTIQHIVIPRC
GNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPRWPRNRRDLTYAFDPKNP
LTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGDHGDGEPFDGVLGTLAHA
FSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLGLGHSSVEESIMYP
TITTGKRKVDLTNDDVEGIQYLYGANPNFNGTTSPPSTTKHQRDTGGFSAAWRIDGSSRS
TIVSLLLSTVGLVLWFLP

Other information
Ka divergence:-0.130835KaKs divergence:0.257247
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1155Length 2 (bp):1137Length divergence:-0.008
MFE 1 (kcal):-382.69MFE 2 (kcal):-390.5MFE divergence0.01