Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24150-AT1G70140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):formin homologue 4
Function (paralog2):formin 8

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2304943643958
Log2 mRNA fold difference:-0.025357864814561
Log2 TE fold difference:-1.1352479145963
Sequences
Protein sequence

MAAMLMQPWPPFLPHLTLVFLTLILFFPNQSFSQSDSPRNIETFFPNDTITPPVQSPVLS
PPQNPSSSSSDSDRGNILRAVLITAASTLLVAAVFFFLVHKCRRRRNRVGGVDNTLQPPV
PPLAEAALAREGFTRFGGNVKGLILDENGLDVLYWRKLQQSQRDNKGGSFRKEIIHGDDE
EKNVIYSKSKKKSGPVTETPLLRGRSSTSHSVIHNDNYRNATTTHPPHVKTDSFEFVKPD
PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRG
SSSGESSNGQVKLKPLHWDKVNPDSDHSMVWDKIDRGSFSFDGDLMEALFGYVAVGKKSP
DDGGDKKPSSASPAQIFILDPRKSQNTAIVLKSLGMTRDELVESLMEGHDFHPDTLERLS
RIAPTKEEQSAILQFDGDTKMLADAESFLFHLLKAVPCAFTRLNALLFRANYYPEISNHN
KNLQTLDLACTELRSRGLFSVDGKTTLLNFVVEEVVRSEGKRCVLNRRTNRSFSRSSSSS
ISEVISKEEQEKEYLRLGLPVVGGLSSEFTNVKKAAAVDYDTVAATCLALTSRAKDARRV
LAQSEGDNKEGVRFVKKMNEFLDSVEEEVKLAKEEEKKVLELVKRTTEYYQAGAVKGKNP
LHLFVIVRDFLAMVDKVCVEIARNLQRRSSMGSTQQRNAVKFPVLPPNFMSDRSRSDSGG
SDSDM

MAAMFNHPWPNLTLIYFFFIVVLPFQSLSQFDSPQNIETFFPISSLSPVPPPLLPPSSNP
SPPSNNSSSSDKKTITKAVLITAASTLLVAGVFFFCLQRCIIARRRRDRVGPVRVENTLP
PYPPPPMTSAAVTTTTLAREGFTRFGGVKGLILDENGLDVLYWRKLQSQRERSGSFRKQI
VTGEEEDEKEVIYYKNKKKTEPVTEIPLLRGRSSTSHSVIHNEDHQPPPQVKQSEPTPPP
PPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAPVRGASGGET
SKQVKLKPLHWDKVNPDSDHSMVWDKIDRGSFSFDGDLMEALFGYVAVGKKSPEQGDEKN
PKSTQIFILDPRKSQNTAIVLKSLGMTREELVESLIEGNDFVPDTLERLARIAPTKEEQS
AILEFDGDTAKLADAETFLFHLLKSVPTAFTRLNAFLFRANYYPEMAHHSKCLQTLDLAC
KELRSRGLFVKLLEAILKAGNRMNAGTARGNAQAFNLTALLKLSDVKSVDGKTSLLNFVV
EEVVRSEGKRCVMNRRSHSLTRSGSSNYNGGNSSLQVMSKEEQEKEYLKLGLPVVGGLSS
EFSNVKKAACVDYETVVATCSALAVRAKDAKTVIGECEDGEGGRFVKTMMTFLDSVEEEV
KIAKGEERKVMELVKRTTDYYQAGAVTKGKNPLHLFVIVRDFLAMVDKVCLDIMRNMQRR
KVGSPISPSSQRNAVKFPVLPPNFMSDRAWSDSGGSDSDM

Other information
Ka divergence:0.26657KaKs divergence:-0.199115
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2178Length 2 (bp):2283Length divergence:0.024
MFE 1 (kcal):-672.25MFE 2 (kcal):-721.46MFE divergence0.035