Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24160-AT1G70100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.3948610923975
Log2 mRNA fold difference:-0.83231717436693
Log2 TE fold difference:-0.51119193585439
Sequences
Protein sequence

MGDMQVGVATIDDKGFYGLMEDTQVKAVASSNPSLQVSVSFGRFENDSLSWEKFSAFSPN
KYLEEVGKCATPGSVAQKKAYFEAHYKKIAERKAEIIDQEKLMDENASFRSIVSDQESVE
CENGGVVVESEVDNGCNGQLSCDEDKHVTDITAKVNQVSIDESNEETIVVKECQSSVDTV
KDEVKDSVDSPVLEKAEEIALEEEKIEMVVHVQERSEEVLQEDEKEETEVREEVRDDISL
QNDTVDANETTKKVVKKEKKPNLIKKNDGNVRINPTRGSLKPNQVGGKPETNKTVTSRKT
PPSKEMKNMMKATKKPAAPMSKSPQGFATPRVYKPAPTKTSLSTSHSSLKKEKVSPLLSK
KQTAPKSLHISMNLDPPASDPTALPSTRKSLIMERMGDKDIVKRAFKSFQKSFDFKSSVD
GLNTAVKQNPAKPTIIPSVATRQKENGRPTKASSMEKRSGTTAYRSPSHGLKSNETAEKQ
QKEISKSGARPLEKTRLQKNPKAGVIDAKTRRDSLNPKAKPVQGSLPMRTVSKSSLDKVL

MVDMEVGIASGEDKITTAASSNQELQVSVSFGKFENDSLSWEKFSSFSPNKYLEEVEKCA
TAGSVAQKKAYFESHYKKIAERRADIIMEQEKLLERNASFRPNIQNRERTDDSDNDESMM
IEFSTGYGSNGESTSEEDKLVTVIVTEVNETCNHKPLEETMDFKECRSSVDTGDDLSTLK
LEEKLEEIVQVEDKEKVEEVICMKEEVKEDVPSKDTGEMSETLMKETKKEKDHNPIKKTD
KNVRTNHMRASPKSNQVTKKPVTSKVVSGRKTQPSKEKSMTKATNKAASPVLKPPGFSTP
RVSKSASTISSMSTSRSSVKKESVSTLLRKKQTAPKSLPISLNVDQSVSDPTAVPTTRKS
LIMERMGDKDIVRRAFKSFQKSFDQMKSTDDGQDTAPKQVLAKATAVQRLGTTGQKNVRL
AKSDGTERKGPNSHRSSSVVSKSNGTAEKQKDPSRLGTRAVERIHLQAKPKAEASNVKTR
RQSLNPKENPIQGPLPKGYSDKVL

Other information
Ka divergence:0.00966647KaKs divergence:-0.429097
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1623Length 2 (bp):1515Length divergence:-0.034
MFE 1 (kcal):-449.29MFE 2 (kcal):-405.18MFE divergence-0.052